Protein Info for HSERO_RS16175 in Herbaspirillum seropedicae SmR1

Annotation: peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 469 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 46 to 66 (21 residues), see Phobius details amino acids 78 to 95 (18 residues), see Phobius details amino acids 101 to 124 (24 residues), see Phobius details amino acids 131 to 150 (20 residues), see Phobius details amino acids 156 to 178 (23 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_3232)

Predicted SEED Role

"FIG00458225: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J1E4 at UniProt or InterPro

Protein Sequence (469 amino acids)

>HSERO_RS16175 peptidase (Herbaspirillum seropedicae SmR1)
VIRLVLLLLGADFIRRNWHVLALAGLSWGAIGVSLAIDALDGVLNFPLTLFGYLLLLESL
VTLWVANSGIGAQKTLRYVKGALFLLIAVLVITQHQASNMALAMLFGIAFAIGGALQITS
ALVVRFPRWRTALVGGGVQILLAIFFFQPYPTHYKGTVPFCLALGLIFGGWNMIWLALRT
RMLPADVSVDMLAARNSGDDRPFDAGVHRDDATLEEMRQPPATPAAAVSAAQPLTVHVWT
PAGSARGPARRQPVIDRYIAAVDTNGVISTGHAALEIPPDLYISLYPAEEIDRSPDQFAR
LLRATADNDVKGRYLSDYPSEAASWCESTEKIVFRDYCRARLDRFWQRYRQTEIYNLTNR
NCSSTVANALESALEGVIGGRNRHWTNALRMIFTPEIWVASHIRKRAVTMAWTPGMVLDY
ARALRAVVHPRPLSWAASLHLALRQSRRLRKGWRARRRYAQQHPPTGDL