Protein Info for HSERO_RS16035 in Herbaspirillum seropedicae SmR1

Annotation: cytochrome C oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 490 transmembrane" amino acids 54 to 72 (19 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details amino acids 175 to 193 (19 residues), see Phobius details amino acids 210 to 228 (19 residues), see Phobius details amino acids 357 to 377 (21 residues), see Phobius details TIGR02745: cytochrome c oxidase accessory protein CcoG" amino acids 51 to 486 (436 residues), 529.9 bits, see alignment E=2.6e-163 PF12801: Fer4_5" amino acids 105 to 147 (43 residues), 40.2 bits, see alignment 7.8e-14 PF13746: Fer4_18" amino acids 229 to 335 (107 residues), 142.9 bits, see alignment E=1.4e-45 PF11614: FixG_C" amino acids 372 to 488 (117 residues), 107.2 bits, see alignment E=1.8e-34

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_3200)

Predicted SEED Role

"Type cbb3 cytochrome oxidase biogenesis protein CcoG, involved in Cu oxidation" in subsystem Biogenesis of cbb3-type cytochrome c oxidases or Terminal cytochrome C oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J1B3 at UniProt or InterPro

Protein Sequence (490 amino acids)

>HSERO_RS16035 cytochrome C oxidase (Herbaspirillum seropedicae SmR1)
MEKAVMKPRQDKEGDPPPDTGDSKTGKDEYAVIRMYAAREQIYPREIQGRFASLRWLCVF
LTQLVFYGLPWINWNERQAVLFDLASRKFYLFGLVLWPQDFIWLAALLIICAFSLFLFTA
VAGRVWCGYSCPQTVYTEIFMWIERRIEGNRSARMRLDRQPWSFDKLWRKSAKHLAWGAV
ALWTGISFVGYFSPIRDLLPEISGFALGPWESFWILFYGFATYGNAGWMREQVCKYMCPY
ARFQSAMFDRDSLIITYDVARGEPRMPAAKAAKLDTGARAGDCIDCTMCVQVCPTGIDIR
QGLQYMCIGCAACVDACDSVMDKIKRPRGLIRYSTENAVEQGFSTAEIRRRLVRPRILIY
GAILGAVIALFAGSLWVRTPLKLDVIRDRGSMGREVEEGIIENVYRLQIINTDERGHRYL
VRAKGLAGLSVDPATPIEVAATQTVSVPVRVRAPHGAGEVGSNKIRIELEAEDQPALNVS
EKAVFLVPRR