Protein Info for HSERO_RS15940 in Herbaspirillum seropedicae SmR1

Annotation: peptide ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 PF00005: ABC_tran" amino acids 25 to 183 (159 residues), 105.8 bits, see alignment E=4.4e-34 TIGR01727: oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain" amino acids 232 to 321 (90 residues), 69.5 bits, see alignment E=9.8e-24 PF08352: oligo_HPY" amino acids 234 to 300 (67 residues), 60.3 bits, see alignment E=2.8e-20

Best Hits

Swiss-Prot: 50% identical to Y4TR_SINFN: Probable peptide ABC transporter ATP-binding protein y4tR (NGR_a01410) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K02031, peptide/nickel transport system ATP-binding protein (inferred from 100% identity to hse:Hsero_3180)

Predicted SEED Role

"Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J193 at UniProt or InterPro

Protein Sequence (334 amino acids)

>HSERO_RS15940 peptide ABC transporter substrate-binding protein (Herbaspirillum seropedicae SmR1)
MSVLLDVKNLKVDLPTENGMLHAVRGIDFQVRRGEMLCLVGESGCGKSMTSLALMGLLPR
KAQCSADHILFDGVDLHGMPDKQLMQLRGKRMAMIFQEPMTSLNPSYTLGNQLCEAMLQQ
PGVSRAEARERALYLLHRTGISNAEDRLRQYPHQLSGGLRQRVMIAMSLMCNPDLIIADE
PTTALDVTIQAQILRMIRELQQEFGAAVIFITHDLGVVSRIADRVAVMYAGQVVETTDVA
QLFAQPRHPYTQGLLNCIPVRGKTLPGSHLQAIPGVVPSLVGQVSGCAFRNRCAKADSGC
ERDPQMVQQGSVTAPHQARCLKLDVAMDAMEVAA