Protein Info for HSERO_RS15805 in Herbaspirillum seropedicae SmR1

Annotation: glucarate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 transmembrane" amino acids 20 to 37 (18 residues), see Phobius details amino acids 57 to 80 (24 residues), see Phobius details amino acids 89 to 110 (22 residues), see Phobius details amino acids 112 to 131 (20 residues), see Phobius details amino acids 155 to 176 (22 residues), see Phobius details amino acids 182 to 204 (23 residues), see Phobius details amino acids 254 to 275 (22 residues), see Phobius details amino acids 290 to 312 (23 residues), see Phobius details amino acids 324 to 344 (21 residues), see Phobius details amino acids 351 to 374 (24 residues), see Phobius details amino acids 385 to 408 (24 residues), see Phobius details amino acids 414 to 435 (22 residues), see Phobius details PF07690: MFS_1" amino acids 27 to 318 (292 residues), 170.7 bits, see alignment E=4.5e-54 TIGR00893: D-galactonate transporter" amino acids 29 to 436 (408 residues), 486.6 bits, see alignment E=2.9e-150 PF00083: Sugar_tr" amino acids 50 to 445 (396 residues), 26.9 bits, see alignment E=2.2e-10

Best Hits

Swiss-Prot: 65% identical to GUDP_BACSU: Probable glucarate transporter (gudP) from Bacillus subtilis (strain 168)

KEGG orthology group: K03535, MFS transporter, ACS family, glucarate transporter (inferred from 100% identity to hse:Hsero_3151)

MetaCyc: 64% identical to galactarate/D-glucarate transporter GudP (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-203; TRANS-RXN0-204; TRANS-RXN0-523

Predicted SEED Role

"D-glucarate permease" in subsystem D-galactarate, D-glucarate and D-glycerate catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J166 at UniProt or InterPro

Protein Sequence (447 amino acids)

>HSERO_RS15805 glucarate transporter (Herbaspirillum seropedicae SmR1)
LAQSKQSGLAGEVAKPTHVRYLILFLLFVVTTVNYADRATLSIAGSAMKTELSLDPVMMG
YIFSAFSWAYVLAQLPGGWLLDRFGSKKIYMWSIALWSVFTFLQAGVTWMSTAAAVASLF
LLRFMVGLAEAPSFPANGRIVAAWFPTKERGTASAIFNSAQYFAAVLFTPLMAWIVHTYS
WHHVFTVMGVVGIALALIWGRIIYSPKDHPRINQAELAHIESGGGLVDMDNRKVAAPSTK
GRGYIRQLLSNRMLLGVYIGQYCINVITYFFLTWFPVYLVQERGMSILKAGFVASIPAVC
GFIGGVVGGLISDRLIKRGLSVTWARKIPIVGGMLLSMTMILCNYVEAQWMVVGIMALAF
FGKGVGALGWAVVADTAPKQIVGLSGGLFNMFGNVAGITTPIVIGYIVKETGSFSGALVF
VGINALVTVISYLVIVKEIKRVELKDA