Protein Info for HSERO_RS15800 in Herbaspirillum seropedicae SmR1

Updated annotation (from data): Galactarate dehydratase (EC 4.2.1.42)
Rationale: Specifically important for utilizing D-Galacturonic Acid monohydrate. Automated validation from mutant phenotype: the predicted function (4.2.1.42) was linked to the condition via a SEED subsystem. This annotation was also checked manually.
Original annotation: D-galactarate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 522 TIGR03248: galactarate dehydratase" amino acids 15 to 522 (508 residues), 947.2 bits, see alignment E=9.2e-290 PF08666: SAF" amino acids 22 to 90 (69 residues), 32.2 bits, see alignment E=2e-11 PF04295: GD_AH_second" amino acids 122 to 269 (148 residues), 125.2 bits, see alignment E=3.1e-40 PF20629: GD_AH_C" amino acids 279 to 518 (240 residues), 309.9 bits, see alignment E=1.6e-96

Best Hits

Swiss-Prot: 67% identical to GARD_BACSU: Probable galactarate dehydratase (L-threo-forming) (garD) from Bacillus subtilis (strain 168)

KEGG orthology group: K01708, galactarate dehydratase [EC: 4.2.1.42] (inferred from 100% identity to hse:Hsero_3150)

Predicted SEED Role

"D-galactarate dehydratase (EC 4.2.1.42)" in subsystem D-Galacturonate and D-Glucuronate Utilization or D-galactarate, D-glucarate and D-glycerate catabolism (EC 4.2.1.42)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.42

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J165 at UniProt or InterPro

Protein Sequence (522 amino acids)

>HSERO_RS15800 Galactarate dehydratase (EC 4.2.1.42) (Herbaspirillum seropedicae SmR1)
MSTDTSASQASAPRYIMMNDTDNVAIVVNDGGLPAGTVFPDGLTLVDRVPQGHKIALRDL
KQGEAIVRYDVAIGYAVRDIPKGGWIEESLVQMPPARELDNLPIATKKPAPQPPLEGYTF
EGYRNADGSVGTRNLLAITTTVQCVAGVVEHAVKRIRAELLPKYPNVEDVVALEHTYGCG
VAIDAPNAGIPIRTLRNISLNPNFGGQAMVVSLGCEKLQPNRLLPENMIPIHKQGEPYVV
CLQDAEHVGFNSMIDSIMNMAEARLTELNKRRRETCPASDLVVGVQCGGSDAFSGVTANP
AVGFATDLLVRAGASVMFSEVTEVRDGIDQLTSRAVNEEVAQAMIREMDWYDNYLKQGGV
DRSANTTPGNKKGGLANIVEKAMGSIVKSGSSPISGVLSPGDKLQQKGLIYAATPASDFI
CGTLQLAAGMNLHIFTTGRGTPYGLAAVPVIKVATRNDLARRWHDLMDVNAGRIASGEAS
IEDVGWELFQLMLDVASGKKRTWAEQWKLHNALTLFNPAPVT