Protein Info for HSERO_RS15795 in Herbaspirillum seropedicae SmR1

Updated annotation (from data): galactaro-1,5-lactonase
Rationale: Specifically important in carbon source D-Galacturonic Acid monohydrate. The lactone is probably formed by HSERO_RS23040 and the product (meso-galactarate) is probably consumed by HSERO_RS15800
Original annotation: 6-phosphogluconolactonase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF10282: Lactonase
  • amino acids 21 to 347 (327 residues), 268.9 bits, E=7.1e-84

Best Hits

KEGG orthology group: K07404, 6-phosphogluconolactonase [EC: 3.1.1.31] (inferred from 100% identity to hse:Hsero_3149)

Predicted SEED Role

"6-phosphogluconolactonase (EC 3.1.1.31)" in subsystem Entner-Doudoroff Pathway or Pentose phosphate pathway (EC 3.1.1.31)

MetaCyc Pathways

• superpathway of glycolysis and the Entner-Doudoroff pathway (15/17 steps found)
• Entner-Doudoroff pathway I (9/9 steps found)
• superpathway of glucose and xylose degradation (14/17 steps found)
• pentose phosphate pathway (7/8 steps found)
• heterolactic fermentation (14/18 steps found)
• pentose phosphate pathway (oxidative branch) I (2/3 steps found)
• formaldehyde oxidation I (3/6 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.31

Sequence Analysis Tools

See D8J164 at UniProt or InterPro

Protein Sequence (352 amino acids)

>HSERO_RS15795 galactaro-1,5-lactonase (Herbaspirillum seropedicae SmR1)
LIATSALSLATSHAGAATIAYVSHADSQDIYVLRLNNDGSVNLIDKVDTGSTVMPLAISP
DRKYLYASLRREPYAVASYAIDPASGKLKALSKAPLADNMANIATDRSGRYLLAASYFGN
KISVNAIGSDGAVQTPPLAVIPTGKNAHSVQVDPANAFVFASNLGSDVILQYRFDPASGA
VTPNTPPSVASKAGAGPRHFVFSPDQRFLYCANELDATVSTYAYDRQAGTLTLLGSDSAL
PEGFQSSEQLAAADLHLTPDGRFLYATERTSNTLTGYRVDRASGKLTRILNIPTETQPRA
FNIDPQGRYLLAVGQKAGLTSYAIDAASGTLTPLFRYTLGRNPNWVEIIDLP