Protein Info for HSERO_RS15785 in Herbaspirillum seropedicae SmR1

Updated annotation (from data): 5-dehydro-4-deoxyglucarate dehydratase (EC 4.2.1.41)
Rationale: Specifically important for utilizing D-Galacturonic Acid monohydrate. Automated validation from mutant phenotype: the predicted function (4.2.1.41) was linked to the condition via a SEED subsystem. This annotation was also checked manually.
Original annotation: 5-dehydro-4-deoxyglucarate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03249: 5-dehydro-4-deoxyglucarate dehydratase
  • amino acids 6 to 303 (298 residues), 445.9 bits, E=2.9e-138
• PF00701: DHDPS
  • amino acids 15 to 301 (287 residues), 175.3 bits, E=6.2e-56

Best Hits

Swiss-Prot: 80% identical to KDGD_PSEPW: Probable 5-dehydro-4-deoxyglucarate dehydratase (PputW619_2814) from Pseudomonas putida (strain W619)

KEGG orthology group: K01707, 5-dehydro-4-deoxyglucarate dehydratase [EC: 4.2.1.41] (inferred from 100% identity to hse:Hsero_3147)

MetaCyc: 70% identical to 5-dehydro-4-deoxyglucarate dehydratase subunit (Acinetobacter baylyi ADP1)
5-dehydro-4-deoxyglucarate dehydratase. [EC: 4.2.1.41]

Predicted SEED Role

"5-dehydro-4-deoxyglucarate dehydratase (EC 4.2.1.41)" in subsystem D-Galacturonate and D-Glucuronate Utilization or D-galactarate, D-glucarate and D-glycerate catabolism (EC 4.2.1.41)

MetaCyc Pathways

• D-galactarate degradation II (3/3 steps found)
• D-glucarate degradation II (3/3 steps found)
• D-glucuronate degradation II (4/5 steps found)
• D-galacturonate degradation II (3/5 steps found)
• superpathway of microbial D-galacturonate and D-glucuronate degradation (16/31 steps found)

KEGG Metabolic Maps

• Ascorbate and aldarate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.41

Sequence Analysis Tools

See D8J162 at UniProt or InterPro

Protein Sequence (306 amino acids)

>HSERO_RS15785 5-dehydro-4-deoxyglucarate dehydratase (EC 4.2.1.41) (Herbaspirillum seropedicae SmR1)
MSQYTPQDLKQILSSGLLSFPLTDFDEQGDFRPKTYIERLEWLAPYGASALFAAGGTGEF
FSLVPGEYSDIIRTAVDTCRGKVPIIAGAGGSTRAAIAYAQEAERLGAHGILLMPHYLTE
ASQDGIAAHVEAVCKSVKFGVIIYNRAVCKLNADTLQKLADRCPNLIGFKDGIGEIEPMV
HIRRKLGDRFTYLGGLPTAEVYAAAYKALGVPVYSSAVFNFIPKTAVEFYQAIAKEDHDT
VGKLIDEFFLPYLAIRNRKAGYAVSIVKAGARIAGHDAGPVRTPLTDCTPEEHEELAALM
NKLGPQ