Protein Info for HSERO_RS15750 in Herbaspirillum seropedicae SmR1

Annotation: lysine transporter LysE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 39 to 63 (25 residues), see Phobius details amino acids 79 to 84 (6 residues), see Phobius details amino acids 118 to 139 (22 residues), see Phobius details amino acids 151 to 177 (27 residues), see Phobius details amino acids 188 to 206 (19 residues), see Phobius details PF01810: LysE" amino acids 13 to 205 (193 residues), 130.4 bits, see alignment E=3e-42

Best Hits

Swiss-Prot: 31% identical to Y136_VIBCH: Uncharacterized membrane protein VC_0136 (VC_0136) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_3140)

Predicted SEED Role

"L-lysine permease" in subsystem Lysine degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J155 at UniProt or InterPro

Protein Sequence (208 amino acids)

>HSERO_RS15750 lysine transporter LysE (Herbaspirillum seropedicae SmR1)
MPDLILFLLAAMTLTLAPGPDNLYVLTRGIAQGRKAGLVAAAGFCSGLVFHTLLAVLGFA
ALIKAYPPAYHALQYAGAAYLAYLGVRTLRSASAGLALAADGQGAAAVPLRRIYWQSVLA
NMLNPKVTLFFIAFLPQFVQREAGHEALQMLVLALVFIVQAFAIFSAIALFSGAVGAYFR
RRASASVHLNRLAGCAFIGLGIRMALPE