Protein Info for HSERO_RS15345 in Herbaspirillum seropedicae SmR1

Annotation: cytochrome BD oxidase subunit II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 379 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 78 to 100 (23 residues), see Phobius details amino acids 122 to 146 (25 residues), see Phobius details amino acids 165 to 191 (27 residues), see Phobius details amino acids 204 to 224 (21 residues), see Phobius details amino acids 267 to 285 (19 residues), see Phobius details amino acids 292 to 315 (24 residues), see Phobius details amino acids 339 to 359 (21 residues), see Phobius details TIGR00203: cytochrome d ubiquinol oxidase, subunit II" amino acids 3 to 379 (377 residues), 481.1 bits, see alignment E=1.4e-148 PF02322: Cyt_bd_oxida_II" amino acids 8 to 361 (354 residues), 346.9 bits, see alignment E=5.6e-108

Best Hits

Swiss-Prot: 55% identical to CYDB_ECOL6: Cytochrome bd-I ubiquinol oxidase subunit 2 (cydB) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K00426, cytochrome bd-I oxidase subunit II [EC: 1.10.3.-] (inferred from 100% identity to hse:Hsero_3058)

MetaCyc: 55% identical to cytochrome bd-I subunit 2 (Escherichia coli K-12 substr. MG1655)
RXN0-5266 [EC: 7.1.1.7]; 1.11.1.- [EC: 7.1.1.7]; 1.11.1.- [EC: 7.1.1.7]

Predicted SEED Role

"Cytochrome d ubiquinol oxidase subunit II (EC 1.10.3.-)" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase or Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases (EC 1.10.3.-)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 7.1.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J0J0 at UniProt or InterPro

Protein Sequence (379 amino acids)

>HSERO_RS15345 cytochrome BD oxidase subunit II (Herbaspirillum seropedicae SmR1)
MIFDYETLKLIWWAFVGVLIIGFALTDGFDFGVGMMLPFAGKNDTERRILINAIGPTWEG
NQTWFITAGGATFAAWPLVYATAFSGFYIALMVLLFSLFFRPVGFDYRSKVADPRWRNAW
DWGLFIGGFVPPLICGVAFGNLLLGVPFHYDDTMRVEYTGSFFALLNPFGLLAGLLSVAM
LLMHGAAFAFVKTEAAVAERSRKTIIGAALVTVLLFIAGGFWVAQMPGYRIVSMPDANSA
FTPLAKTVEVVAGAWFDNYAKWPVTKLFPALGVAGAVLAALLALVRSARLAFIASALSVT
GIILTAGMSLFPFVMPSSLDAKSSLTLWDSVSSHKTLGLMFWMVLIFLPLIIVYTGWVYR
VVKGKVTARDIHENEHTAY