Protein Info for HSERO_RS15340 in Herbaspirillum seropedicae SmR1

Annotation: cytochrome BD oxidase subunit I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 541 transmembrane" amino acids 20 to 45 (26 residues), see Phobius details amino acids 57 to 79 (23 residues), see Phobius details amino acids 99 to 119 (21 residues), see Phobius details amino acids 130 to 150 (21 residues), see Phobius details amino acids 190 to 211 (22 residues), see Phobius details amino acids 218 to 240 (23 residues), see Phobius details amino acids 391 to 414 (24 residues), see Phobius details amino acids 425 to 446 (22 residues), see Phobius details amino acids 474 to 496 (23 residues), see Phobius details PF01654: Cyt_bd_oxida_I" amino acids 10 to 504 (495 residues), 582 bits, see alignment E=2.9e-179

Best Hits

Swiss-Prot: 71% identical to CYDA_AZOVI: Cytochrome bd ubiquinol oxidase subunit 1 (cydA) from Azotobacter vinelandii

KEGG orthology group: K00425, cytochrome bd-I oxidase subunit I [EC: 1.10.3.-] (inferred from 100% identity to hse:Hsero_3057)

MetaCyc: 66% identical to cytochrome bd-I subunit 1 (Escherichia coli K-12 substr. MG1655)
RXN0-5266 [EC: 7.1.1.7]; 1.11.1.- [EC: 7.1.1.7]; 1.11.1.- [EC: 7.1.1.7]

Predicted SEED Role

"Cytochrome d ubiquinol oxidase subunit I (EC 1.10.3.-)" in subsystem Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases (EC 1.10.3.-)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 7.1.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J0I9 at UniProt or InterPro

Protein Sequence (541 amino acids)

>HSERO_RS15340 cytochrome BD oxidase subunit I (Herbaspirillum seropedicae SmR1)
MVPIDEVVSLSRLQFAVTALYHFLFVPLTLGLSWILVIMESVYVMTGNQIYKDMTRFWGK
LFGINFAMGVATGITLEFQFGTNWSYYSHYVGDIFGTPLAIEGLMAFFLESTFVGLFFFG
WDKLSRKQHLIVTVLVALGSNLSALWILIANGWMNNPVGAEFNFETMRMELVSMTDVIFN
PVAQVKFVHTVAAGYVTASMFVLGVSAWYLLKARDTAFALRSFAVAAGFGLAATLSVIVL
GDESGYTAGEVNKVKLAAIEAEWDTHPAPAGLTLFGLPNDKEERTDYAVKIPYVLGLIAT
RSADTQVLGIKDLKKEHEARIRNGMLAYAALTKLKSGDKSPEARAEFDKLKKDLGYGLLL
KKYTNKVVDATPEQISMAVNDTIPKVAPLFWSFRGMVALGFLFLFIFSASFWFLAKKQLA
PQRWLLRLAVISIPLPWIAAELGWIVAEYGRQPWTIAGILPTHLSASSLQPGSLYFSLAG
FILFYTFLLVVEMILMVKYARLGPSSLHTGQYYWENKGKESGPGDVLPPPLNPSANAGNH
P