Protein Info for HSERO_RS15055 in Herbaspirillum seropedicae SmR1

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 transmembrane" amino acids 20 to 46 (27 residues), see Phobius details amino acids 53 to 70 (18 residues), see Phobius details amino acids 82 to 101 (20 residues), see Phobius details amino acids 108 to 127 (20 residues), see Phobius details amino acids 140 to 163 (24 residues), see Phobius details amino acids 175 to 194 (20 residues), see Phobius details amino acids 204 to 225 (22 residues), see Phobius details amino acids 237 to 254 (18 residues), see Phobius details PF01925: TauE" amino acids 20 to 249 (230 residues), 94.1 bits, see alignment E=5.4e-31

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 100% identity to hse:Hsero_3000)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J0D2 at UniProt or InterPro

Protein Sequence (260 amino acids)

>HSERO_RS15055 membrane protein (Herbaspirillum seropedicae SmR1)
MSSFLSSIDMSATVLPASLPVFMLAGFVKGSIGLGLPTVAVGLLSLMMPPVQAAPLLIVP
SMVTNGWQLLTGGALRALVRRLWTLLAGIVLGTLAGGSFMNADGGRRAIIVLGLALVLYA
LAGLASWTPSVSPAQEQWWSPAVGLATGLVTAATGVFVIPAVPYLQALGLPREQLIQALG
LSFTVSTLALAVNLGQGGAFSGGVGWASLVLLLPALLGMSIGARVRGRVQAVTFRRCFFI
GLLLLGLHLASALLRQGGAA