Protein Info for HSERO_RS14795 in Herbaspirillum seropedicae SmR1

Annotation: histidyl-tRNA synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 TIGR00442: histidine--tRNA ligase" amino acids 13 to 415 (403 residues), 515.5 bits, see alignment E=5.2e-159 PF13393: tRNA-synt_His" amino acids 15 to 317 (303 residues), 168.5 bits, see alignment E=4.4e-53 PF01409: tRNA-synt_2d" amino acids 29 to 137 (109 residues), 21 bits, see alignment E=4.2e-08 PF00587: tRNA-synt_2b" amino acids 78 to 321 (244 residues), 79.5 bits, see alignment E=7e-26 PF03129: HGTP_anticodon" amino acids 336 to 434 (99 residues), 38.7 bits, see alignment E=1.8e-13

Best Hits

Swiss-Prot: 68% identical to SYH_PARP8: Histidine--tRNA ligase (hisS) from Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)

KEGG orthology group: K01892, histidyl-tRNA synthetase [EC: 6.1.1.21] (inferred from 100% identity to hse:Hsero_2952)

Predicted SEED Role

"Histidyl-tRNA synthetase (EC 6.1.1.21)" (EC 6.1.1.21)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IZV0 at UniProt or InterPro

Protein Sequence (451 amino acids)

>HSERO_RS14795 histidyl-tRNA synthetase (Herbaspirillum seropedicae SmR1)
MSEQKKVEKIVGVKGMNDILPADAPLWELFENTVQSVLKSYGFQQIRTPIVEPTALFARG
LGEVTDIVEKEMYSFTDSMNGDNLTLRPENTAGVVRAALEHNLTYDGPKRLWYVGPMFRH
ERPQRGRYRQFHQVGAEAVGFSGPDIDAELIMMCQRLWDDLGLSDIRLELNSIGNAEERN
KHRADLIAYFEQHKDLLDTDAQRRLHANPLRILDTKNPAMQEMVNAAPKLLDYLGEESRA
HFEGVQKILRHNNIPFTINPRLVRGMDYYNRTVFEWVTDQLGSQGTVCGGGRYDPLIEMF
GGKPTPACGFAMGVERLLELMKASGEQYAPNQCDVYLVHQGEDAQLQSFVLAERLRTAGL
DVVLHCASSNGGGSFKAQMKRADASGAAFAVIIGEDELKGGTATVKHMREGNAEEGRANQ
NSLPFDGVVDYIVEQIVGDHDHDHDHVHYHP