Protein Info for HSERO_RS14785 in Herbaspirillum seropedicae SmR1

Annotation: serine/threonine protein kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 signal peptide" amino acids 23 to 23 (1 residues), see Phobius details transmembrane" amino acids 24 to 43 (20 residues), see Phobius details TIGR03300: outer membrane assembly lipoprotein YfgL" amino acids 27 to 395 (369 residues), 424.8 bits, see alignment E=1.2e-131 PF13570: PQQ_3" amino acids 66 to 104 (39 residues), 19.7 bits, see alignment 1.4e-07 amino acids 105 to 144 (40 residues), 23 bits, see alignment 1.3e-08 amino acids 145 to 184 (40 residues), 25.9 bits, see alignment 1.6e-09 PF13360: PQQ_2" amino acids 94 to 325 (232 residues), 207.6 bits, see alignment E=3.5e-65 amino acids 309 to 394 (86 residues), 24.4 bits, see alignment E=3.3e-09 PF01011: PQQ" amino acids 128 to 162 (35 residues), 22.2 bits, see alignment 1.4e-08

Best Hits

Swiss-Prot: 44% identical to BAMB_RALP1: Outer membrane protein assembly factor BamB (bamB) from Ralstonia pickettii (strain 12D)

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_2950)

Predicted SEED Role

"Outer membrane protein YfgL, lipoprotein component of the protein assembly complex (forms a complex with YaeT, YfiO, and NlpB)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IZU8 at UniProt or InterPro

Protein Sequence (399 amino acids)

>HSERO_RS14785 serine/threonine protein kinase (Herbaspirillum seropedicae SmR1)
MRSVTATAAQASSIARSRRAGKMALKLAAVAAVVALSGCSWFSSKKNPNPPAPLVEFTQK
LRVQTAWSVSVGKAGNFQFSPVYAAGSIFAAGNDGTVVRINAQTGQTLWRARTDMSLTAG
VGSDGSTVVVVGEKGRIQAFDANTGKPTWNAQAASEVLSAPAVGEGLVVIRSIDNRVTAY
DADSGNQRWMVQRNVPSLTLRNAPGIVIGSQTAFVALPGGRLSALALNNGGPRWEVPVGD
PRGTTELERISDVSGVPALGSRDICAVAYQGRIGCFDLLNGNVRWIKEFSSDVGVTLDDS
YVYAADVGGIVTEFSRDTGAVVWRNERLKNRQLSSPIGAGKAVAVGDYEGYIHFLSREDG
SFVARLSTDGSPIQAPPVSTGSSVVFQTKSGTVVSVVTE