Protein Info for HSERO_RS14650 in Herbaspirillum seropedicae SmR1

Annotation: porphyrin biosynthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 40 to 59 (20 residues), see Phobius details TIGR00540: heme biosynthesis-associated TPR protein" amino acids 3 to 392 (390 residues), 397.9 bits, see alignment E=2e-123 PF07219: HemY_N" amino acids 26 to 131 (106 residues), 105.1 bits, see alignment E=2.1e-34

Best Hits

KEGG orthology group: K02498, HemY protein (inferred from 100% identity to hse:Hsero_2921)

Predicted SEED Role

"Uncharacterized protein EC-HemY, likely associated with heme metabolism based on gene clustering with hemC, hemD in Proteobacteria (unrelated to HemY-type PPO in GramPositives)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IZS0 at UniProt or InterPro

Protein Sequence (399 amino acids)

>HSERO_RS14650 porphyrin biosynthesis protein (Herbaspirillum seropedicae SmR1)
MKILLWLLTLFASAIGLAVLARFNPGNVVLFYPPYRIDLSLNFFIFAVLAVFLVIYVVIR
AIRLTQKLPGRVIAYRRAKRENESNKALRDALKAYFEGRFGQAEKSATRASDLPDNAGIA
ALIGARAAHRMRQGERRDIWLASTEVDPTLKAARLMTALELQVDEHHFKQALETVEELNA
NGTRHIQALQWALKANQQAKNWPEVLRLVQTLDKRNALHPALSNRLREMSYDALLSDRSH
DAESIRLLWNAVPSADKLKPYIAVRAAQAFSSRGLHDEARSLLERGLAADWDIRLLRAYR
ESTAEAGSPALLSQIEHCESWLSKNPTDAELALTLGMFCLRQKLWGKAQRHLEQALSDAI
EPRTVRESHLALAQLHEALDQPDQAAAHYKQCALATAIR