Protein Info for HSERO_RS14405 in Herbaspirillum seropedicae SmR1

Annotation: molybdenum transport protein ModE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 transmembrane" amino acids 181 to 199 (19 residues), see Phobius details TIGR00638: molybdenum-pterin binding domain" amino acids 127 to 194 (68 residues), 65 bits, see alignment E=2.5e-22 amino acids 200 to 267 (68 residues), 59.4 bits, see alignment E=1.4e-20 PF03459: TOBE" amino acids 129 to 190 (62 residues), 58.7 bits, see alignment E=5.5e-20 amino acids 202 to 264 (63 residues), 67 bits, see alignment E=1.4e-22

Best Hits

Swiss-Prot: 100% identical to MODE_HERSE: Molybdenum transport protein ModE (modE) from Herbaspirillum seropedicae

KEGG orthology group: K02019, molybdate transport system regulatory protein (inferred from 100% identity to hse:Hsero_2874)

Predicted SEED Role

"DNA-binding domain of ModE / Molybdate-binding domain of ModE" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IZM6 at UniProt or InterPro

Protein Sequence (269 amino acids)

>HSERO_RS14405 molybdenum transport protein ModE (Herbaspirillum seropedicae SmR1)
MSTLPATDTTLLSSELKLVHRLDQRFFALLDAIAQTGSINRAASTAGYSYKGAWMLLESA
GNLVNGALIETVTGGKGGGGTRLTPAAVELLAVWRELQRRNLEFLHRQETWLNQLPALAG
LLRRMSMKTSARNQFAGVISAIDTGPVTTQVTVTIAGAQEIVATMTTTAANRLKLRIGSN
AIALIKSSAVVLVTDFAGFSLSARNQFEGTVSRVERGAVSSLVVLTLPGGACMTASLTND
AIDALSLAVGQTATAVFKAYAVMVAVQQD