Protein Info for HSERO_RS14280 in Herbaspirillum seropedicae SmR1

Annotation: nitrogenase molybdenum-cofactor synthesis protein NifN protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 TIGR01285: nitrogenase molybdenum-iron cofactor biosynthesis protein NifN" amino acids 4 to 431 (428 residues), 612.2 bits, see alignment E=2.8e-188 PF00148: Oxidored_nitro" amino acids 19 to 429 (411 residues), 372 bits, see alignment E=1.7e-115

Best Hits

Swiss-Prot: 56% identical to NIFN_RHILO: Nitrogenase iron-molybdenum cofactor biosynthesis protein NifN (nifN) from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)

KEGG orthology group: K02592, nitrogenase molybdenum-iron protein NifN (inferred from 100% identity to hse:Hsero_2849)

Predicted SEED Role

"Nitrogenase FeMo-cofactor scaffold and assembly protein NifN" in subsystem Nitrogen fixation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IZK1 at UniProt or InterPro

Protein Sequence (462 amino acids)

>HSERO_RS14280 nitrogenase molybdenum-cofactor synthesis protein NifN protein (Herbaspirillum seropedicae SmR1)
MAIIETSSKAAAVNPLKMSQPLGAAYAFLGMNRCMPVMHGSQGCTSFGLVLLVRHFREAI
PLQTTAMNEVSSILGGMENIEKAVLNIRLRAKPDLIAICSTGLTETKGDDVNAYLRLIRQ
KHPDLADTALAYVSTPDYTGAFQDGWAKAVEALIRALGEPQPGLQTRAKQINLLAGCHLT
PADIEELRDIVQSFGLEPIVLPDVSSSLDGHLPDNFSPTSMGGTTLAEMRALGASIVSIA
IGEQMRASAQAVQELSGVPYVVFDRLTGLQANDRFLAYLEYVSGQPIPARYRRQRSQLQD
AMLDGHFFFGGVKVAIGAEPDLLLSLSAWLAEMGCEIGCAVTTTTSPVLDGVPAARVVIG
DLEDLEQGARRASAGLLVTHSHGRQAAERLHIPFHRAGLPMFDRLGAGHCLSVGYRGTRG
LIFEIGNLLLAAGHAHTPDDWQLPQSTRDALALATPVQGESS