Protein Info for HSERO_RS14250 in Herbaspirillum seropedicae SmR1

Annotation: molybdate ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF13531: SBP_bac_11" amino acids 24 to 248 (225 residues), 195.4 bits, see alignment E=1.2e-61 PF01547: SBP_bac_1" amino acids 29 to 238 (210 residues), 55.2 bits, see alignment E=1.2e-18 TIGR01256: molybdate ABC transporter, periplasmic molybdate-binding protein" amino acids 29 to 246 (218 residues), 240.4 bits, see alignment E=1e-75

Best Hits

Swiss-Prot: 63% identical to MODA_AZOVI: Molybdate-binding protein ModA (modA) from Azotobacter vinelandii

KEGG orthology group: K02020, molybdate transport system substrate-binding protein (inferred from 100% identity to hse:Hsero_2843)

Predicted SEED Role

"Molybdenum ABC transporter, periplasmic molybdenum-binding protein ModA (TC 3.A.1.8.1)" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum (TC 3.A.1.8.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A7L4W6 at UniProt or InterPro

Protein Sequence (251 amino acids)

>HSERO_RS14250 molybdate ABC transporter substrate-binding protein (Herbaspirillum seropedicae SmR1)
MLRTLMLACTWLWLLMPVVHAEEVHVAVAANFTQPFKQIAAAFEQATGHKVVAAFGSTGQ
FYAQINNGAPFEILLAADADTPALLEKQKTAVAGTRFTYARGKLVLWSAKPGVVDAQGEI
LKKGAFEHLSLANPKLAPYGLAGVQTMQKLGLEEALRPKIVQAENVNQAYQFIASGNALL
GFVALSQVVRNGQIADGSAWIVPADLYAPILQDAVLLEKGRDHPAALALMTYLKSEPARQ
VIRGYGYELDR