Protein Info for HSERO_RS14240 in Herbaspirillum seropedicae SmR1

Annotation: molybdenum ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 TIGR02142: molybdate ABC transporter, ATP-binding protein" amino acids 26 to 371 (346 residues), 454.9 bits, see alignment E=1.1e-140 PF00005: ABC_tran" amino acids 32 to 177 (146 residues), 107.3 bits, see alignment E=1e-34 PF03459: TOBE" amino acids 309 to 371 (63 residues), 49.4 bits, see alignment E=4.3e-17

Best Hits

Swiss-Prot: 62% identical to MODC1_AZOVI: Molybdenum import ATP-binding protein ModC 1 (modC1) from Azotobacter vinelandii

KEGG orthology group: K02017, molybdate transport system ATP-binding protein [EC: 3.6.3.29] (inferred from 100% identity to hse:Hsero_2841)

Predicted SEED Role

"Molybdenum transport ATP-binding protein ModC (TC 3.A.1.8.1)" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum (TC 3.A.1.8.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.29

Use Curated BLAST to search for 3.6.3.29

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A7L4W8 at UniProt or InterPro

Protein Sequence (372 amino acids)

>HSERO_RS14240 molybdenum ABC transporter ATP-binding protein (Herbaspirillum seropedicae SmR1)
MKQAMVGPSIAQPGIIAKMAYGYGGAGEFQLDLDLTLPGQGVSALSGPSGCGKTTFLRCM
AGLLRPSRGYLEVNGEVWQDSQRQYFLPTHRRALGYVFQEASLLPHLSVSRNLDYGARRS
GAVSSAASRQKIIDLLGIAALLQSMPSALSGGERQRVAIARALFTAPRLLLMDEPMAALD
NDRKRDILPYLERLRDELAIPILYISHHPEEIARLADTLVLMRQGRCLASGPLTTLLSRL
DLPLAHAEDAGAVIEAKVAAHDETYHLTRLVLAGGEIFVPRRELPVGQSVRLQIHARDVS
LALSPSHDSSILNRLSATVLKLAPAQHPAHVLAVLDAGGEQLLARITRRSCDQLALVAGQ
PVWAQIKSVALL