Protein Info for HSERO_RS14225 in Herbaspirillum seropedicae SmR1

Annotation: protein fixB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 transmembrane" amino acids 337 to 347 (11 residues), see Phobius details PF01012: ETF" amino acids 29 to 210 (182 residues), 150.5 bits, see alignment E=4.9e-48 PF00766: ETF_alpha" amino acids 236 to 313 (78 residues), 119.8 bits, see alignment E=3.9e-39

Best Hits

Swiss-Prot: 68% identical to FIXB_AZOVI: Protein FixB (fixB) from Azotobacter vinelandii

KEGG orthology group: K03522, electron transfer flavoprotein alpha subunit (inferred from 100% identity to hse:Hsero_2838)

MetaCyc: 68% identical to quinone reductase (NADH,flavodoxin) complex electron transfer flavoprotein component beta subunit (Azotobacter vinelandii)

Predicted SEED Role

"Electron transfer flavoprotein, alpha subunit" in subsystem Acetyl-CoA fermentation to Butyrate

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IYZ5 at UniProt or InterPro

Protein Sequence (364 amino acids)

>HSERO_RS14225 protein fixB (Herbaspirillum seropedicae SmR1)
MNQEKPAPERKGGKGKYELDERLKAYQGVWVFIEHERGEVHPVSWELLGEGRKLADQLGV
SLSGVVLGAPDLATRQFCEQAFHHGADSCYLMADPTLSAYRNQPFTKGLTDLVNRYQPEI
LLLGATAQGRDLAGSVATTLKTGLTADCTGLTIDMENRSMAASRPTFGGSLLCTILTLNY
RPQMATVRPRVMAMPEPDRSRSGQIIEHPLCLVESDIITKVLEYIPDNQQDKPQLPFADI
IVAGGRGMKRAENFQLIWDLAMVLGAEVGATRPVVQANWVQAERQVGQSGKTVRPKLYIA
AGISGAIQHRVGMADSDVIIAINSDPNAPIFDFASYGIVGNAMTILPALTEAFRQQLTTM
RMAS