Protein Info for HSERO_RS14120 in Herbaspirillum seropedicae SmR1

Annotation: ABC transporter permease and ATPase components protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 594 transmembrane" amino acids 40 to 61 (22 residues), see Phobius details amino acids 81 to 107 (27 residues), see Phobius details amino acids 156 to 181 (26 residues), see Phobius details amino acids 193 to 220 (28 residues), see Phobius details amino acids 286 to 336 (51 residues), see Phobius details amino acids 422 to 441 (20 residues), see Phobius details PF06472: ABC_membrane_2" amino acids 43 to 308 (266 residues), 153.7 bits, see alignment E=1e-48 PF05992: SbmA_BacA" amino acids 43 to 355 (313 residues), 92 bits, see alignment E=7.8e-30 PF00005: ABC_tran" amino acids 401 to 531 (131 residues), 60.8 bits, see alignment E=3.4e-20

Best Hits

KEGG orthology group: K02471, putative ATP-binding cassette transporter (inferred from 100% identity to hse:Hsero_2816)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IYX4 at UniProt or InterPro

Protein Sequence (594 amino acids)

>HSERO_RS14120 ABC transporter permease and ATPase components protein (Herbaspirillum seropedicae SmR1)
MTQEALHDLSYAEVEGSQRAHFRTSTWWLFKSYWTSREAPVSALLAAFIVGSGFVGVYFS
LRVNQWTGKFYDAIGSGRFGTIPALLTLFLGLIMVAATLAISASVAADVLKLRWRTWLTT
TLIDQWTRSGAYFRIERDKLLDNADQRISEDVKLFVDYTVTITSHLIHVPVSAVTFSIVL
WELSGNYLLELGHLAITIPAYMLFAVYLYSGSTLLLTHLLGRSLIPVNIRQQKVEADFRA
LMVQIREGAEQIAFYDGASVEASRLRSTFASIRANTWRIIRVTAQVMFGVQVPGQISSIL
PVLLVLPQLMAGTMTLGGMMRVSAAFGSVSSTLAYFPQAYQSFAAWRAVVRRLLALLDAN
EIKSPTFELTVLQRPQQTTIEVGALTLTDPHGNPLSRIPAFSVKHGARCLIRGRSGSGKS
TLLRALAGIWPFGIGSITVPARTSMMFVPQKSYVPVGSLRQALAYPGAETDVSDALAQDI
LAAVGLAQFLPLLDQPDRWGGRLSGGEQQRLAFARILIARPDHIFIDEATSALDDESEQR
MYSLLLERLPHSTLISVAHRKEVAAFHDQFVDLTPDVVATSAPGAVSNQPKSKE