Protein Info for HSERO_RS13965 in Herbaspirillum seropedicae SmR1

Annotation: single-stranded DNA exonuclease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 564 transmembrane" amino acids 186 to 202 (17 residues), see Phobius details TIGR00644: single-stranded-DNA-specific exonuclease RecJ" amino acids 23 to 559 (537 residues), 491.3 bits, see alignment E=1.4e-151 PF01368: DHH" amino acids 73 to 231 (159 residues), 86.3 bits, see alignment E=3.1e-28 PF02272: DHHA1" amino acids 320 to 446 (127 residues), 82.6 bits, see alignment E=5.6e-27 PF17768: RecJ_OB" amino acids 463 to 560 (98 residues), 78.3 bits, see alignment E=6.7e-26

Best Hits

KEGG orthology group: K07462, single-stranded-DNA-specific exonuclease [EC: 3.1.-.-] (inferred from 100% identity to hse:Hsero_2781)

Predicted SEED Role

"Single-stranded-DNA-specific exonuclease RecJ (EC 3.1.-.-)" in subsystem DNA-replication or DNA Repair Base Excision or DNA repair, bacterial RecFOR pathway (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IYU1 at UniProt or InterPro

Protein Sequence (564 amino acids)

>HSERO_RS13965 single-stranded DNA exonuclease (Herbaspirillum seropedicae SmR1)
MIRVATRTYDLVQAEQLINEGVHPVLARVYAARGLSSARELASELNALIAPSGLLHIDAA
ASYLADAIAARKKLVIVADYDCDGATACAVGLRGLRLLGAQVDYIVPNRFEYGYGLTPEI
VELTVREKNPDIIVTVDNGIASIDGVAEAKRRGIDVVVTDHHLPGDALPQARVIVNPNQP
QCGFPSKNLAGVGVMFYVLLALRAEMRKRGLFDAQTQPRLDSLLDLVALGTVADVVKLDA
NNRILVAQGLKRMRSGKMHPGIAALFRAAGREARRATPFDLGFAVGPRLNAAGRLADMSL
GIECLTTDDEGRAWAIAQQLDAINRERRDIEAGMQDTALLLLDDYNPADRRTIAVFDPSW
HQGVIGIVASRLKDKFYRPTITFAPGDEGFIKGSGRSIAGFHLRDALDLVSKHAPSVMTK
FGGHAMAAGLTIHAEAFDAFSHAFEAVGRDWLTQNQLERVIETDGVLEDAYYSVEFITLM
DQQVWGQGFAPPVFCDHFRVLNQRILKEKHLKLQLEKDGRRYDAIWFGHTDSLPELAKVA
FRLDANEYNGRTTVQLMVEHAEPA