Protein Info for HSERO_RS13925 in Herbaspirillum seropedicae SmR1

Annotation: alpha/beta hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF12697: Abhydrolase_6" amino acids 22 to 268 (247 residues), 44.5 bits, see alignment E=7.8e-15 PF00561: Abhydrolase_1" amino acids 62 to 161 (100 residues), 40.7 bits, see alignment E=5.7e-14 PF07819: PGAP1" amino acids 79 to 121 (43 residues), 26.2 bits, see alignment 1.7e-09 PF00756: Esterase" amino acids 81 to 166 (86 residues), 27 bits, see alignment E=8.8e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_2773)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IYT3 at UniProt or InterPro

Protein Sequence (280 amino acids)

>HSERO_RS13925 alpha/beta hydrolase (Herbaspirillum seropedicae SmR1)
MLPPLQCCFAARFAMSLPILHFAHANSYPAGTYGMFFEQLRAHYDVRALPIHAHDPRFPV
DDGWRTLARELREELERSYHEPVILVGHSMGGILSLMAARKRPALVRCVVLLDSPIVAGW
RAQVLRLTKVFRYDSRYSPANASARRRDHWPDMEAAYQHYAAKSVFAAWPQQVLRDYVQH
GLVPQAGGGVRLRFSRETETAVYRTIPHHLGPLVRQPYPLPIGFVGGIDSVECRMAGLEA
TRRLVGRHFRQIPGGHLFPMEAPVAAAEATHAMIGELLGR