Protein Info for HSERO_RS13900 in Herbaspirillum seropedicae SmR1

Annotation: transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 transmembrane" amino acids 7 to 31 (25 residues), see Phobius details amino acids 38 to 57 (20 residues), see Phobius details amino acids 63 to 80 (18 residues), see Phobius details amino acids 99 to 119 (21 residues), see Phobius details amino acids 128 to 144 (17 residues), see Phobius details amino acids 152 to 168 (17 residues), see Phobius details amino acids 174 to 192 (19 residues), see Phobius details PF04973: NMN_transporter" amino acids 16 to 194 (179 residues), 182.4 bits, see alignment E=3.8e-58 TIGR01528: nicotinamide mononucleotide transporter PnuC" amino acids 18 to 196 (179 residues), 75.7 bits, see alignment E=2.2e-25

Best Hits

KEGG orthology group: K03811, nicotinamide mononucleotide transporter (inferred from 100% identity to hse:Hsero_2768)

Predicted SEED Role

"Ribosyl nicotinamide transporter, PnuC-like" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation or PnuC-like transporters

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IYS8 at UniProt or InterPro

Protein Sequence (203 amino acids)

>HSERO_RS13900 transporter (Herbaspirillum seropedicae SmR1)
MSPDTPLSLLGLSTTPLELVSFALAVITVWLNIRQNHWAWLFSILSSVLYAAVFADARLY
GDAGLQFVFVAVSVWGWYQWLRGGVAHQPLAVSRLQRGGWGLMLAAWLAGWWVLSWFLQR
YTDTDVPHMDGFLTAGSLVGQFLLSRKKIENWLVWIAVDVLYVGLYVYKHLSLTAMLYAL
FVLMAAAGWRSWRRAAAQAGRPA