Protein Info for HSERO_RS13825 in Herbaspirillum seropedicae SmR1

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02917: putative PEP-CTERM system TPR-repeat lipoprotein
  • amino acids 18 to 905 (888 residues), 861.6 bits, E=3.1e-263
• PF13432: TPR_16
  • amino acids 38 to 95 (58 residues), 29.3 bits, 8.1e-10
  • amino acids 137 to 198 (62 residues), 26.3 bits, 7.2e-09
  • amino acids 171 to 231 (61 residues), 22.4 bits, 1.2e-07
  • amino acids 206 to 266 (61 residues), 28.8 bits, 1.2e-09
  • amino acids 237 to 299 (63 residues), 30.2 bits, 4.2e-10
  • amino acids 271 to 334 (64 residues), 17.9 bits, 3e-06
  • amino acids 310 to 368 (59 residues), 17.5 bits, 4.1e-06
  • amino acids 341 to 403 (63 residues), 28.8 bits, 1.2e-09
  • amino acids 375 to 432 (58 residues), 30.8 bits, 2.8e-10
  • amino acids 444 to 503 (60 residues), 38.3 bits, 1.2e-12
  • amino acids 510 to 570 (61 residues), 15.6 bits, 1.5e-05
  • amino acids 593 to 641 (49 residues), 20.6 bits, 4.1e-07
  • amino acids 767 to 811 (45 residues), 19.6 bits, 8.9e-07
  • amino acids 851 to 906 (56 residues), 24.9 bits, 1.9e-08
• PF14559: TPR_19
  • amino acids 45 to 94 (50 residues), 31.2 bits, 1.8e-10
  • amino acids 277 to 342 (66 residues), 25.4 bits, 1.2e-08
  • amino acids 414 to 477 (64 residues), 28.6 bits, 1.1e-09
  • amino acids 482 to 546 (65 residues), 36.9 bits, 2.9e-12
  • amino acids 854 to 924 (71 residues), 32.5 bits, 7e-11
• PF13181: TPR_8
  • amino acids 67 to 96 (30 residues), 16.2 bits, see alignment (E = 7.3e-06)
  • amino acids 136 to 162 (27 residues), 17.2 bits, see alignment (E = 3.6e-06)
  • amino acids 369 to 401 (33 residues), 14.7 bits, see alignment (E = 2.3e-05)
  • amino acids 475 to 503 (29 residues), 21.4 bits, see alignment (E = 1.6e-07)
  • amino acids 643 to 674 (32 residues), 12.3 bits, see alignment (E = 0.00014)
• PF07719: TPR_2
  • amino acids 474 to 503 (30 residues), 25.3 bits, see alignment (E = 8.9e-09)
• PF13174: TPR_6
  • amino acids 609 to 640 (32 residues), 18 bits, see alignment (E = 2.8e-06)
• PF13429: TPR_15
  • amino acids 679 to 897 (219 residues), 32.1 bits, E=6.3e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_2755)

Predicted SEED Role

No annotation

Sequence Analysis Tools

See D8IYR6 at UniProt or InterPro

Protein Sequence (924 amino acids)

>HSERO_RS13825 hypothetical protein (Herbaspirillum seropedicae SmR1)
MLESKRMGRLCAVVFAVALVCAGVTACGRFKSADSLVDEARQYQQKGDSAAAEIQLKNAL
QKDGENAQARLMLGQIYLANGNAASAEKELRRALSLGIKPEQVVPALTQSLLLQGQFAKA
LEQTAALPAQGEIAALRGNAYLGLGKSAEAKAAFETALQSDAKLPTALIGLARSALLERK
LDTATRYADEAIAKNPDNNEVLMFKAHLLSSQGATDEAAAVLGQVIKRKPDQVDALLARA
DLEIRQRQFAQAEADIQAAQKAKPKNLLATYMQSLLAFSQGKHADALTEIQKVQAGAPDY
MPAALLAGAIQYALGSMPQAELSLGKYLDKVPDDNYARKLLASAQLKNGQKAKAAATLEP
ALKSGQQDAELLALAGEIAIENKDFAKAADYYEKASALAPQSARYHMGLGLSNLGRGQTD
SAAAQFQTAASLDTKSSQAGVLLVMTHMRQKEYDKALAAANAAEKEQPANPIVQNLKGGV
YLAQNDYANARKAFEKALAIDPSFFAATANLAQLDLKDNQPELARKRFEAVLATDKKSIP
AMTALATLAERNGHPQEATQWLERAVNENPESVQASAQLIARYLLTDQKEKGLTMARKLQ
ASNPGDAVALEMLGQAQFASGDTQGALASYQRLATLQPDSAPTQLRLASLYQSAKDVQGA
ADAARKALEIQPDYTDAEIFRATLFSQNGEPAKALAIAQQMQKRPAQALVGYELEGNLQA
FQNKPELAAAAFGQAFARDKENVRLLMKLHGALLLAGKDAAADTLAAQWFKSHPKDFALH
LYLGETALSRKQNKQAIEQYQLALRQQPDNAGALNNLAWAYQQEGDARALPTAEKAYAAA
SDSAPVIDTLGWMLVEKGHTERGLPLLKKAVAAAPEAMDIRLHLAQALVKAGDKSGARSE
LEKILASPKGSAQNEQARALLAQL