Protein Info for HSERO_RS13710 in Herbaspirillum seropedicae SmR1

Annotation: exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 49 to 70 (22 residues), see Phobius details amino acids 82 to 103 (22 residues), see Phobius details amino acids 109 to 131 (23 residues), see Phobius details amino acids 278 to 301 (24 residues), see Phobius details amino acids 441 to 460 (20 residues), see Phobius details TIGR03025: exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase" amino acids 20 to 460 (441 residues), 408.2 bits, see alignment E=5.9e-126 TIGR03013: sugar transferase, PEP-CTERM system associated" amino acids 21 to 460 (440 residues), 538.4 bits, see alignment E=1.6e-165 PF02397: Bac_transf" amino acids 273 to 456 (184 residues), 231.1 bits, see alignment E=3.4e-73

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_2732)

Predicted SEED Role

"FIG071646: Sugar transferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IYP3 at UniProt or InterPro

Protein Sequence (461 amino acids)

>HSERO_RS13710 exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase (Herbaspirillum seropedicae SmR1)
MFRISNHYVSKIVAVLLFIELGVLFAAGYLGVNLRFMGKPEYLSDFRQFWAPVGVTALSI
LLGMSAVGMYQRNIDENLRATLLRLMPSFGIALLVMMVVFYAAPELSLGRVLLVIVLLLS
ALGILCVRTIFFRLVNSPMLASPILFLGSSELVRDCMETSHQNLRNHKYNIVGTIPVAGE
DSTLAMLVEPAGSLLETARKYKAEEIVVAVQNRRGGALRIQELLECKMKGVRVTDAAGFF
EREACQIRLDSLHPSWLVFGSGFDQSLLRTFFKRSFDLITSCIMLPLLSPLMLGAAICIW
LEDRGPVLYRQERVGKNNEHFMVLKFRSMRVDAEKAGTPQWASSGDPRITRVGNVMRKYR
IDELPQLFNVLRGDMSFVGPRPERPYFVEQFAREITFYNVRHCVKPGITGWAQVRYKYGA
SKDDAVQKLQYDLYYVKNNSLFLDVLILIDTLSVVIFGAGT