Protein Info for HSERO_RS13700 in Herbaspirillum seropedicae SmR1

Annotation: Fis family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 TIGR02915: PEP-CTERM-box response regulator transcription factor" amino acids 8 to 450 (443 residues), 739.3 bits, see alignment E=7.5e-227 PF00072: Response_reg" amino acids 9 to 119 (111 residues), 63.4 bits, see alignment E=6.2e-21 PF00158: Sigma54_activat" amino acids 149 to 314 (166 residues), 231 bits, see alignment E=2e-72 PF14532: Sigma54_activ_2" amino acids 158 to 319 (162 residues), 67.4 bits, see alignment E=4.7e-22 PF07728: AAA_5" amino acids 172 to 290 (119 residues), 28.2 bits, see alignment E=5.1e-10 PF02954: HTH_8" amino acids 408 to 441 (34 residues), 33.4 bits, see alignment 9.1e-12

Best Hits

KEGG orthology group: K02481, two-component system, NtrC family, response regulator (inferred from 100% identity to hse:Hsero_2730)

Predicted SEED Role

"Response regulatory protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IYP1 at UniProt or InterPro

Protein Sequence (450 amino acids)

>HSERO_RS13700 Fis family transcriptional regulator (Herbaspirillum seropedicae SmR1)
VSENKPKLLIVEDDPGLQKQLRWSLDAYEVLVAGDRESALAMVRRHEPAVVTMDLGLPPD
PDGASEGFATLQQVLALAPDTKVIMLTGNQDHAHAVKAISMGAYDFHQKPCIDETLRLVV
QRAFYLHALQRENQRMQQAGGHTALGGLITRDAGMLAVCRSIEKVAPSSASVMLLGSSGT
GKEVLARALHQLSPRSGRRFMAINCAAIPENLLESELFGYEKGAFTGAAKQTIGKVELAH
GGTFFLDEVGDLPMPLQAKLLRFLQERVIERVGGHTEIPVDVRVICATHQNLKELTASGG
FREDLYYRLCEIIIKIPALKERHGDAVLLARHFVQKFCAKEGRATLHLSQDAVAAIERYE
WPGNVREMENCVMRAVIMADGQQITAEDLGLSVEGREAEPLNLRQVRDEAERKAVVKALT
RMDGNILKAAELLGVSRPTLYDLMSRHEIK