Protein Info for HSERO_RS13695 in Herbaspirillum seropedicae SmR1

Annotation: acyl-CoA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 539 transmembrane" amino acids 32 to 52 (21 residues), see Phobius details amino acids 67 to 88 (22 residues), see Phobius details TIGR03098: acyl-CoA ligase (AMP-forming), exosortase A-associated" amino acids 5 to 526 (522 residues), 737.6 bits, see alignment E=3.4e-226 PF00501: AMP-binding" amino acids 12 to 382 (371 residues), 286.3 bits, see alignment E=3.4e-89 PF13193: AMP-binding_C" amino acids 444 to 518 (75 residues), 38.9 bits, see alignment E=1.4e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_2729)

Predicted SEED Role

"Acetyl-coenzyme A synthetase (EC 6.2.1.1)" in subsystem Ketoisovalerate oxidoreductase or Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 6.2.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.2.1.1

Use Curated BLAST to search for 6.2.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IYP0 at UniProt or InterPro

Protein Sequence (539 amino acids)

>HSERO_RS13695 acyl-CoA ligase (Herbaspirillum seropedicae SmR1)
VTPTLIHDTLLASAQARPQATALRYRGQQLDYAGLAAGVEQVAAALLALGLGPGERVAVY
LEKRMETVLALFGAAAAGLVFVPINPLLKPAQVSHILQDCAVRVLVSSEPRHPALADRLS
QCPALQTVVLVDAAAAAPATPAPPAPLGRLATLDWNAFLQAAPGPGSRRAHRRIDADIAA
ILYTSGSTGQPKGVVLSHRNLVAGAQSVAGYLGNHPQDRLLAVLPLSFDYGLSQLSTAFL
SGASVTLLNYLAPRDILHAVASEGITGLAGVPPLWQQLAGLPWPQGCSLRYLTNSGGALP
RSVLAQLRRALPQAQVFLMYGLTEAFRSTYLPPAELDRRPDSIGRAIPNAEIMVVRPDGS
PCAPGEVGELVHRGALVAQGYWNDPARTAERFRPAPGREAALGTPELAVWSGDSVRMDEQ
GYLYFVGRADDMIKVSGYRISPHEVEEVLHATGLADQFAVVGVAHPQQGQAVVAVVPSSC
TASLEAVQQACRAHLPSYMLPAALHRWPGELPRSPNGKLDRKLMQQTLADHFMKADHAR