Protein Info for HSERO_RS13635 in Herbaspirillum seropedicae SmR1

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 39 to 56 (18 residues), see Phobius details amino acids 68 to 87 (20 residues), see Phobius details amino acids 99 to 120 (22 residues), see Phobius details amino acids 130 to 155 (26 residues), see Phobius details amino acids 167 to 186 (20 residues), see Phobius details amino acids 205 to 224 (20 residues), see Phobius details amino acids 230 to 252 (23 residues), see Phobius details amino acids 283 to 303 (21 residues), see Phobius details PF13593: SBF_like" amino acids 9 to 317 (309 residues), 367.9 bits, see alignment E=4.8e-114 PF01758: SBF" amino acids 41 to 218 (178 residues), 54.8 bits, see alignment E=1e-18

Best Hits

Swiss-Prot: 66% identical to Y2026_PSEAE: Uncharacterized protein PA2026 (PA2026) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K14347, solute carrier family 10 (sodium/bile acid cotransporter), member 7 (inferred from 100% identity to hse:Hsero_2717)

Predicted SEED Role

"Sodium/bile acid symporter family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IYM8 at UniProt or InterPro

Protein Sequence (335 amino acids)

>HSERO_RS13635 membrane protein (Herbaspirillum seropedicae SmR1)
MARPRFLPDNMTLLLLAVVVTASLLPCTGQVAEVFDGLTTFMIGLLFFMHGAKLSREAVV
AGFTHWKLHVTVLLCTFALFPLVGLAFKPLLTPFITPELYLGLLFLCVLPSTVQSSIAFT
SVARGNVPAAICAASASNLLGIFLTPLLVGALVVAHEGAGHSSLDSILKIVYQLLLPFVA
GQIARPWIGRWIERNKSWLKFVDQSSILLVVYVAFSEAVVQGLWHQVPMSMLVALLVINA
VLLALIMALTTYGSRRLGFSKEDEITIVFCGSKKSLASGVPMAKVLFSSGAIGMVLLPVM
LFHQLQLMVCAVLAARYGARQEEVEAAVASESGGD