Protein Info for HSERO_RS13265 in Herbaspirillum seropedicae SmR1

Annotation: G3E family GTPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 transmembrane" amino acids 17 to 38 (22 residues), see Phobius details PF02492: cobW" amino acids 18 to 206 (189 residues), 134.1 bits, see alignment E=4.3e-43 PF07683: CobW_C" amino acids 284 to 370 (87 residues), 43.9 bits, see alignment E=1.7e-15

Best Hits

KEGG orthology group: K02234, cobalamin biosynthesis protein CobW (inferred from 100% identity to hse:Hsero_2648)

Predicted SEED Role

"CobW GTPase involved in cobalt insertion for B12 biosynthesis" in subsystem Coenzyme B12 biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IXP2 at UniProt or InterPro

Protein Sequence (377 amino acids)

>HSERO_RS13265 G3E family GTPase (Herbaspirillum seropedicae SmR1)
MSVALSLPELAPALPPIPVTVVTGFLGAGKTTLLRGLLQRRQSRRLALLINEFGEVAIDG
DLLRAEGDAQGQVQIQDFAHGLIAYGDDAHFVPAMLALAARRAQIDHVLIETSGLALPSA
VMEVLQGAEMARHFVLDATLAVVDTPLLLEDAFASADAVGAATAQLFRQQLECADVVVLN
KIDGMEEAPLLQAEQAVRALAPNVRFLELAYGARLDIRLALGLRLHQAGATVHHHYTPVS
MPGERAQVAPDQRRFNGHVHSGLGAHSHGLSTHKHFHEQDPGWQSFTLRSLAHQDAERLR
QAVAAAALAEPILRAKGFVHTDQGARLVQAVRARVVVAESGQGGGRGGSSELVFIGYHPS
RAKVARILSETTGVDWT