Protein Info for HSERO_RS13090 in Herbaspirillum seropedicae SmR1

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 signal peptide" amino acids 1 to 39 (39 residues), see Phobius details transmembrane" amino acids 74 to 98 (25 residues), see Phobius details amino acids 106 to 128 (23 residues), see Phobius details amino acids 161 to 182 (22 residues), see Phobius details amino acids 203 to 226 (24 residues), see Phobius details amino acids 264 to 286 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 100 to 293 (194 residues), 55.2 bits, see alignment E=4e-19

Best Hits

KEGG orthology group: K05815, sn-glycerol 3-phosphate transport system permease protein (inferred from 100% identity to hse:Hsero_2615)

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, permease protein UgpE (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IXK9 at UniProt or InterPro

Protein Sequence (298 amino acids)

>HSERO_RS13090 ABC transporter permease (Herbaspirillum seropedicae SmR1)
MVERHPRMTALAYCVLGLGLLLALGPLYLILCSASVTSQAWISQGMPLTPGTALLENLRE
VAQRIDLWRYLFNSLLVASLVVSGKLLLSSVTAFAVSYFRPRCRGLILVLLFSALLLPLE
VRIVPTYAAASDLLEPLRSLLQALDLSGQQAVPSISLVNTYAGLSLPLVASATGTFLFLQ
FYRTIPPELVEAARIDGAGPWRFYVDILLPLSKTNFAALGAIVFISTWKDYMWPLVITSH
EQMRTITLAMASFLPVESGQMPQWNLLMAAALAAIAVPAVFVVAAQRWFVKGIVGTEK