Protein Info for HSERO_RS12680 in Herbaspirillum seropedicae SmR1

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 transmembrane" amino acids 24 to 48 (25 residues), see Phobius details amino acids 57 to 79 (23 residues), see Phobius details amino acids 86 to 105 (20 residues), see Phobius details amino acids 111 to 131 (21 residues), see Phobius details amino acids 147 to 168 (22 residues), see Phobius details amino acids 176 to 200 (25 residues), see Phobius details amino acids 229 to 255 (27 residues), see Phobius details amino acids 267 to 286 (20 residues), see Phobius details amino acids 293 to 311 (19 residues), see Phobius details amino acids 317 to 340 (24 residues), see Phobius details amino acids 358 to 377 (20 residues), see Phobius details amino acids 383 to 402 (20 residues), see Phobius details PF07690: MFS_1" amino acids 31 to 253 (223 residues), 58.4 bits, see alignment E=6e-20 amino acids 279 to 408 (130 residues), 43.9 bits, see alignment E=1.6e-15 PF00083: Sugar_tr" amino acids 54 to 125 (72 residues), 23.1 bits, see alignment E=3.4e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_2536)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IWL5 at UniProt or InterPro

Protein Sequence (417 amino acids)

>HSERO_RS12680 MFS transporter (Herbaspirillum seropedicae SmR1)
MTTATSTALPASAPDASGARNARVLALCQGLFTCAISIDLTLTALTGWQLAPDKSLATLP
FALITVAGAVVTWFAAFLIQRLGRRWSFVLGAASCCVGGLVSVWSVWQGHFWSFCAGTAL
VGVFQAFAQYYRLAAADAVPEAAKSRAIATVLAGGVIAALVGPALAAWSKDWIPTALFAG
AYLVVAAMGLLSVLALLLFYRDQPVAAVRTESDGAPARALGQIVRTPVFLASVANNVAGS
MVMMFIMTAAPLAAVACHHGIDDGAAIIQWHLMGMYAPSFFAGRLVQRVGLGPVLLAGLA
MNLGCAVVAMLSTTLPAFYLALLLLGVGWNFMFVGGTTLLAQSYAPSERAKTQGFSELLR
YAATALATLGAGPLLARFGWQTLNLAILPVLLLSALATLHWMRGQRRAATLPPAGLR