Protein Info for HSERO_RS12630 in Herbaspirillum seropedicae SmR1

Annotation: chemotaxis protein CheY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 PF06490: FleQ" amino acids 2 to 83 (82 residues), 22.1 bits, see alignment E=2.4e-08 PF00072: Response_reg" amino acids 3 to 112 (110 residues), 92.6 bits, see alignment E=2.7e-30 PF00486: Trans_reg_C" amino acids 144 to 217 (74 residues), 68 bits, see alignment E=9.6e-23

Best Hits

Swiss-Prot: 42% identical to QSEB_ECO57: Transcriptional regulatory protein QseB (qseB) from Escherichia coli O157:H7

KEGG orthology group: K07774, two-component system, OmpR family, response regulator TctD (inferred from 100% identity to hse:Hsero_2527)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IWK6 at UniProt or InterPro

Protein Sequence (239 amino acids)

>HSERO_RS12630 chemotaxis protein CheY (Herbaspirillum seropedicae SmR1)
MRILLVEDTADVAEAIVTHLNRIGHTVEWESNGAHASRRLSESYDLLILDVMLPQQDGFS
LLQQLRTRGHHTPVLMLTACAEVEERVRALDLGADDYLVKPFDFRELDARIRVLLRRSGG
ESTNLLHCANLSIDRKSRSATLDGQPIELTRREVTLLEIIAARPGRIFNKDELMDRLFTV
DDNPSANSVEQYVARLRKKLAAAAFEIRTLRGLGYQLVLHAPAEPGAGAGTAAHTSPLH