Protein Info for HSERO_RS12625 in Herbaspirillum seropedicae SmR1

Annotation: sulfonate ABC transporter ATP-binding lipoprotein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 PF00005: ABC_tran" amino acids 38 to 179 (142 residues), 115.3 bits, see alignment E=5.4e-37

Best Hits

Swiss-Prot: 43% identical to TAUB_RUEPO: Taurine import ATP-binding protein TauB (tauB) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: K02049, sulfonate/nitrate/taurine transport system ATP-binding protein (inferred from 100% identity to hse:Hsero_2526)

Predicted SEED Role

"Taurine transport ATP-binding protein TauB" in subsystem Taurine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IWK5 at UniProt or InterPro

Protein Sequence (263 amino acids)

>HSERO_RS12625 sulfonate ABC transporter ATP-binding lipoprotein (Herbaspirillum seropedicae SmR1)
MSDHAQGASSIDPSRPLLEIDRVTLQYKTTDSLVTATQSVSFNVHPGDRYILLGPSGCGK
STLLKAIGGYLQPTSGAIRLKGREVHEPGPDRMMVFQEFDQLLPWKTVRQNVEFALHASG
RLQGRAAAERAEYYISKVGLAKFIDSYPHMLSGGMKQRVSIARGMAMEPDVLLMDEPFAA
LDALTRRKMQDELLRLWDDTQFTVLFVTHSIEEAIRVGTRILLLTPHPGQVRAELNSIDP
SQLGTAAQAELETRINDMLFAHH