Protein Info for HSERO_RS12335 in Herbaspirillum seropedicae SmR1

Annotation: voltage-gated chloride channel protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 442 transmembrane" amino acids 19 to 41 (23 residues), see Phobius details amino acids 52 to 71 (20 residues), see Phobius details amino acids 98 to 114 (17 residues), see Phobius details amino acids 146 to 171 (26 residues), see Phobius details amino acids 183 to 204 (22 residues), see Phobius details amino acids 216 to 239 (24 residues), see Phobius details amino acids 259 to 280 (22 residues), see Phobius details amino acids 322 to 369 (48 residues), see Phobius details amino acids 372 to 373 (2 residues), see Phobius details amino acids 375 to 397 (23 residues), see Phobius details PF00654: Voltage_CLC" amino acids 61 to 391 (331 residues), 247.5 bits, see alignment E=1.1e-77

Best Hits

Swiss-Prot: 73% identical to ERIC_PSESM: Chloride/fluoride channel protein (eriC) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_2467)

Predicted SEED Role

"Chloride channel protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IWE6 at UniProt or InterPro

Protein Sequence (442 amino acids)

>HSERO_RS12335 voltage-gated chloride channel protein (Herbaspirillum seropedicae SmR1)
MKNHHYPEQLYLLPYIGKWTLIACLIAALAGSASAFFLFALDWATHWRERHAWIIWLLPL
GGFAVGWLYLHTGKPVEAGNNLLIDEIHDPRKVIPLRMAPLVLLGTVASHLFGASVGREG
TAVQMGGALADQLTHLLRLRPEDRRILLMAGISAGFSSVFGTPMAGAIFGLEVLAIGRMR
YEAIFPCFVAAIAADQVGLAWGVHHTHYAMNASAPMALWSVAAVIAAGVVFGLAGMIFAN
STHTLSAFMKRHVSYAPLRPFIGGFIVALAVWAVGTHRYIGLGIPVIVEAFQQPLAPWDF
LGKMVFTVTSLGSGFKGGEVTPLFYIGATLGNALAPLLHLPFPLLAGIGFVAVFAGAANT
PLASTIMAIELFGPQIGPFAALACVVAYLFSGHTGIYHAQRVGQAKLGLLPKGLRIGEVG
GYRRKLSAAPAEQASELDQHRK