Protein Info for HSERO_RS12290 in Herbaspirillum seropedicae SmR1

Annotation: chemotaxis protein CheY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 178 PF00072: Response_reg" amino acids 8 to 116 (109 residues), 76.8 bits, see alignment E=2.3e-25 PF02954: HTH_8" amino acids 136 to 174 (39 residues), 41.8 bits, see alignment 1.1e-14

Best Hits

Swiss-Prot: 45% identical to ACTR_SINMW: Acid tolerance regulatory protein ActR (actR) from Sinorhizobium medicae (strain WSM419)

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_2458)

Predicted SEED Role

"Dna binding response regulator PrrA (RegA)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IWD7 at UniProt or InterPro

Protein Sequence (178 amino acids)

>HSERO_RS12290 chemotaxis protein CheY (Herbaspirillum seropedicae SmR1)
MPADRLLLIIEDDAAFARTLGRSFERRGYTVLLAASQEEAAQHLQQHRPGYAVVDLKLGG
NASGLACVQMLHAHDEDMLIVVLTGFASITTAVEAIKLGACQYLAKPSNTDDIEAAFGHV
AGVSEVELPARATSIKTLEWERIHEVLVDTDFNISETARRLGMHRRTLARKLEKQRVK