Protein Info for HSERO_RS12265 in Herbaspirillum seropedicae SmR1

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 525 TIGR00229: PAS domain S-box protein" amino acids 20 to 140 (121 residues), 66.1 bits, see alignment E=1.7e-22 PF00989: PAS" amino acids 21 to 128 (108 residues), 39.4 bits, see alignment E=1.9e-13 PF13426: PAS_9" amino acids 31 to 131 (101 residues), 77.2 bits, see alignment E=3.6e-25 PF08447: PAS_3" amino acids 41 to 121 (81 residues), 32.9 bits, see alignment E=2.2e-11 PF02518: HATPase_c" amino acids 260 to 381 (122 residues), 74.9 bits, see alignment E=2.4e-24 PF00072: Response_reg" amino acids 404 to 514 (111 residues), 56.9 bits, see alignment E=7.9e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_2453)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IWD2 at UniProt or InterPro

Protein Sequence (525 amino acids)

>HSERO_RS12265 histidine kinase (Herbaspirillum seropedicae SmR1)
VRNDLAKVAVGNDINDIFFAAVEMTRMPMIVSDPNRPDNPIVFVNNAFINMTGYSSAEVV
GKNCRFLQGPETDRSVVAEVRRAVAERREIATELLNYRKNGSTFWNALFISPVYDQQGNL
KYFFSSQLDISRRRDAEQALGQARKMEALGQLTGGIAHDFNNLLQVITGYLDMINLALRS
DKPDLARVARSADSIRKASGKAAMLTQQLLAFARKQRLEGRTINLNSLTEGFTDLVSRTL
GGDITVQTELARGLWNCRLDPTQMEVALLNVLINARDAMNGRGRVRIRTANEDLADPDRA
VQLGLKEGLYVSIAVTDDGPGIAPDILPRVMDPFFTTKDEGKGTGLGLSMVYGFVKQSGG
SVRITSGAEGGTTVTIYFPATQDQVGGGFEYDNRSQSQGGQEHILVVDDRLEVAELAQTM
LESLGYRVSMVNSPAEALQLIRSGRPVDLLFTDLIMPGSMNGVVLAREAKRMLPTIKVLL
TTGYASESLERHGADGEFPVLDKPYRHDELARKIRIVLDGATGVS