Protein Info for HSERO_RS12130 in Herbaspirillum seropedicae SmR1

Updated annotation (from data): 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase IolD (EC 3.7.1.22)
Rationale: Specifically important for utilizing m-Inositol.
Original annotation: 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 625 TIGR04377: 3,5/4-trihydroxycyclohexa-1,2-dione hydrolase" amino acids 12 to 623 (612 residues), 937.9 bits, see alignment E=1.5e-286 PF02776: TPP_enzyme_N" amino acids 14 to 139 (126 residues), 65.9 bits, see alignment E=4.5e-22 PF00205: TPP_enzyme_M" amino acids 227 to 358 (132 residues), 120.4 bits, see alignment E=7.2e-39 PF02775: TPP_enzyme_C" amino acids 426 to 579 (154 residues), 118.6 bits, see alignment E=3.2e-38

Best Hits

KEGG orthology group: K03336, 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [EC: 3.7.1.-] (inferred from 100% identity to hse:Hsero_2428)

Predicted SEED Role

"Epi-inositol hydrolase (EC 3.7.1.-)" in subsystem Inositol catabolism (EC 3.7.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.7.1.- or 3.7.1.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IVI8 at UniProt or InterPro

Protein Sequence (625 amino acids)

>HSERO_RS12130 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase IolD (EC 3.7.1.22) (Herbaspirillum seropedicae SmR1)
MNAQVNVRPTLRLTMAQALVRYLDALRIQTPQGVLPLFGGVFSIFGHGNVAGMGEALYQY
RATLPTYRAHNEQAMAHSAIAYAKAHLRQRMMAVTTSIGPGATNLLTAAALAHVNRLPVL
LLPGDVFVSRRPDPVLQQLEDFNDPGLSVNDAFRPLSRMFDRICYPEQLLTALPRAIQVL
TDPAQCGPVTLALPQDVQTMAYDYPLDFFSPRVIVPRAQAPAAQELEDAVALLRQARQPL
LIAGGGVLYGNACEHLRRFAEQHGVPVAETQAGKSALPWSHALQMGAIGVTGSPAANALA
QEADVVIAVGTRLQDFTTGSHTLFAQARLLNLNVNAMDAHKWRGLALQADAGLGLEALSH
ALEGWRSAPEWHARAHTLAQDWRERVAQITGQTDTGGRLPYDGEVIGAIQRSVADSPSQD
IVVCAAGTLPAELHKLWRAGRPGAYHVEYGYSCMGYEVAGGLGVKLAQPQREVIVIVGDG
SYLMMNSELATSVMLGAKLIVVVLDNRGYGCINRLQQACGGAPFNNMLADCLQAGPGAPA
IDFAAHARSLGALGENVKTITELEAALQRARAADRSYLVCIDTDASRTTDDGGCWWEVAV
PEVSPRSQVQQARSQYEQARQAQSV