Protein Info for HSERO_RS12025 in Herbaspirillum seropedicae SmR1
Annotation: enoyl-ACP reductase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 46% identical to FABI1_RHIME: Enoyl-[acyl-carrier-protein] reductase [NADH] 1 (fabI1) from Rhizobium meliloti (strain 1021)
KEGG orthology group: K00208, enoyl-[acyl-carrier protein] reductase I [EC: 1.3.1.9] (inferred from 100% identity to hse:Hsero_2406)MetaCyc: 42% identical to enoyl-acyl carrier protein reductase (Bacillus subtilis subtilis 168)
Enoyl-[acyl-carrier-protein] reductase (NADH). [EC: 1.3.1.9]
Predicted SEED Role
"Enoyl-[acyl-carrier-protein] reductase [NADH] (EC 1.3.1.9)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.3.1.9)
MetaCyc Pathways
- superpathway of fatty acids biosynthesis (E. coli) (50/53 steps found)
- superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
- palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
- superpathway of unsaturated fatty acids biosynthesis (E. coli) (19/20 steps found)
- oleate biosynthesis IV (anaerobic) (13/14 steps found)
- palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (9/9 steps found)
- superpathway of fatty acid biosynthesis I (E. coli) (14/16 steps found)
- biotin biosynthesis I (13/15 steps found)
- cis-vaccenate biosynthesis (5/5 steps found)
- fatty acid elongation -- saturated (5/5 steps found)
- gondoate biosynthesis (anaerobic) (4/4 steps found)
- 8-amino-7-oxononanoate biosynthesis I (9/11 steps found)
- (5Z)-dodecenoate biosynthesis I (5/6 steps found)
- stearate biosynthesis II (bacteria and plants) (5/6 steps found)
- 8-amino-7-oxononanoate biosynthesis IV (4/5 steps found)
- (5Z)-dodecenoate biosynthesis II (4/6 steps found)
- anteiso-branched-chain fatty acid biosynthesis (24/34 steps found)
- even iso-branched-chain fatty acid biosynthesis (24/34 steps found)
- odd iso-branched-chain fatty acid biosynthesis (24/34 steps found)
- streptorubin B biosynthesis (20/34 steps found)
- mycolate biosynthesis (25/205 steps found)
- superpathway of mycolate biosynthesis (26/239 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 1.3.1.9
Use Curated BLAST to search for 1.3.1.9
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See D8IVG6 at UniProt or InterPro
Protein Sequence (255 amino acids)
>HSERO_RS12025 enoyl-ACP reductase (Herbaspirillum seropedicae SmR1) MSCSLEGKRGLIVGIADKHSIAWGCARALRAAGADLAVTWLNESARRYVEPLADQVQASI MCGLDVTHPGEMEQVFDLIRTHWGSLDFVLHSIAFAPAPDLHGRVTNCSSQGFSLAMDVS CHSFIRMARLAEPLMKNGGSLLTMSYIGAEEVVVNYGVMGPVKAALESAVRYLAMELGPA GIRVNAVSPGPLATRAASGLNCFEQFLTDAARRSPLRRLANIDDVGDMCSFLVSDAASVI TGNTLYVDAGYHIVA