Protein Info for HSERO_RS11955 in Herbaspirillum seropedicae SmR1

Annotation: stress protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 149 PF00011: HSP20" amino acids 49 to 149 (101 residues), 76 bits, see alignment E=2.2e-25 PF04969: CS" amino acids 51 to 137 (87 residues), 22.3 bits, see alignment E=2.2e-08

Best Hits

Swiss-Prot: 36% identical to HS17B_ARATH: 17.6 kDa class I heat shock protein 2 (HSP17.6B) from Arabidopsis thaliana

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_2392)

Predicted SEED Role

"Small heat shock protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IVF2 at UniProt or InterPro

Protein Sequence (149 amino acids)

>HSERO_RS11955 stress protein (Herbaspirillum seropedicae SmR1)
MNRDLPSLAPLSDVARFDPIGSFEDLLREIRQAPLGRWMEARQTMKMDVSENESSYTVKA
ELPGMKKENIKVDVDGNKVSIAAEASENQEEKNGDTWIRCERSSERLHRVFSLAHEVDGE
KSVARYEDGVLTLVLPKKNGKQSRQINVQ