Protein Info for HSERO_RS11700 in Herbaspirillum seropedicae SmR1

Annotation: TonB-dependent receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 804 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details PF07660: STN" amino acids 66 to 113 (48 residues), 38.3 bits, see alignment 1.4e-13 PF07715: Plug" amino acids 164 to 269 (106 residues), 76 bits, see alignment E=4.6e-25 TIGR01783: TonB-dependent siderophore receptor" amino acids 167 to 803 (637 residues), 320.1 bits, see alignment E=1.8e-99 PF00593: TonB_dep_Rec" amino acids 375 to 772 (398 residues), 187 bits, see alignment E=1.8e-58

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 100% identity to hse:Hsero_2337)

Predicted SEED Role

"Ferrichrome-iron receptor" in subsystem Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IV97 at UniProt or InterPro

Protein Sequence (804 amino acids)

>HSERO_RS11700 TonB-dependent receptor (Herbaspirillum seropedicae SmR1)
VLSALPKWVAAPLAWRLLLVVAMLLLWPVVTQAQGAPEARRHFNVAAGPLEDALNRFARQ
AGITMSYASALVQGRQVTALQGEYSVSQGLEVLLAGSGLRAVRSDNGAYALQPLVQGAPE
QVDTLHRLGNITVSGRRDEPGAADPVEGYVALRSATATKTDTPLLELAQSVSVVTRAEME
ARGANSILDVLRYMPGANTETHGVDPRGYDYFNLRGFINAQTTSNYLNGLRQIPSGFGMF
RTETYGLERVEVLRGANSASFGQADPGGVVNRVSKLAGSGARNELMVDVGSFQRRQVAAD
LSGDLDPEGRVQARLVGLLLDGDTQFRYANGRAGDNDRLYLAPSLKIRPSADTSLILLAE
YLKDRSGSGRWTAVRADGSQTHTLLGDPDFDQQRGEQWSLGWMLEHRLDATWTLRQHFRQ
AALRSQYAAVNPGSFNGSILSRSTAVYDTQVENTLLDNQALARVQWGQAEHQVLLGLDWS
HMSAREQRYRGVAPSLDIDNPVYTQPIPAATTRFGDLDQTLVQTGLYAQDQIRYQRIVLT
LGARYDRSRDSTRNAANNSLQAAEENAFSGRVGLSYLVSPELAPYVSYGSSFLPQAGQDV
DGKPFKAATARQIEAGVKYQPGHGRAVYTAALYQLVKDNALGSDPLHANFSVSNGQVRSR
GVELEAKGELLPGLNVTAAYTYAQVVNTQNAAPELIGKTPILVPRQAASLWLDYTVQRGD
LAGMGVGAGARYTGRNYATAANTVENAAQVILDAMVRIDRGPWRYAFNVSNLANRQYTSC
LAEPTLTCFWAPERTAVLSARYRW