Protein Info for HSERO_RS11610 in Herbaspirillum seropedicae SmR1

Annotation: NADH dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 522 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 39 to 61 (23 residues), see Phobius details amino acids 68 to 93 (26 residues), see Phobius details amino acids 105 to 121 (17 residues), see Phobius details amino acids 127 to 146 (20 residues), see Phobius details amino acids 167 to 190 (24 residues), see Phobius details amino acids 202 to 226 (25 residues), see Phobius details amino acids 238 to 256 (19 residues), see Phobius details amino acids 267 to 286 (20 residues), see Phobius details amino acids 298 to 323 (26 residues), see Phobius details amino acids 325 to 339 (15 residues), see Phobius details amino acids 355 to 375 (21 residues), see Phobius details amino acids 382 to 400 (19 residues), see Phobius details amino acids 413 to 434 (22 residues), see Phobius details amino acids 445 to 466 (22 residues), see Phobius details PF00361: Proton_antipo_M" amino acids 122 to 346 (225 residues), 125.5 bits, see alignment E=1.3e-40

Best Hits

KEGG orthology group: K05577, NADH dehydrogenase I subunit 5 [EC: 1.6.5.3] (inferred from 100% identity to hse:Hsero_2319)

Predicted SEED Role

"NADH dehydrogenase, subunit 5" in subsystem Respiratory Complex I

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IV79 at UniProt or InterPro

Protein Sequence (522 amino acids)

>HSERO_RS11610 NADH dehydrogenase (Herbaspirillum seropedicae SmR1)
MFTLSHLTSLLPWAPPAAMFVTALALMLARPTPQGLWRLFQATSMLALTLAVLSLCLARG
ATPWPGVLQVSVIGLVLAVLVQGLGAVIGAFSARYLQGEGGQRQYAVALAAVLTAVHLLL
LADHWLVLIAAWAAVGLALEHLLCFYPERPFARLAAYKKRIADRLADLLLGVAALLAWSA
TGSGSLSALWQHLAAHGMSAGLQVSALCVVLAVILRTALLPVHGWLIQVMEAPTPVSALL
HAGVVNLGGFVLIRFAPLLQQAIPARSVLLLMAVATVLLAGMVMLTRISIKVRLAWSTVA
QMGFMLLECAAGLYTFAALHLIGHSLYKAHAFLSASSVVRETRLQALHDKAQPSAASVIV
APLASSAVVLALQTLHAHTGWPWWWSVVLGLAWAPLLWLPQASTVSTAMRLRSWLLGLTG
AAGLTVAAMLLHLLPLGLDDFAQPLFGMATLAGMLALYGCVALLLVRPQAMTAWRRRSYA
GFYLDEAYTRLALQLWPARWAPQARRAPHRAPPSTLASDTQG