Protein Info for HSERO_RS11595 in Herbaspirillum seropedicae SmR1

Annotation: ArsR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 110 PF12840: HTH_20" amino acids 31 to 79 (49 residues), 29.3 bits, see alignment E=6.6e-11 PF01022: HTH_5" amino acids 34 to 78 (45 residues), 53 bits, see alignment E=2.5e-18

Best Hits

Swiss-Prot: 48% identical to BIGR_AGRFC: Biofilm growth-associated repressor (bigR) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_2316)

Predicted SEED Role

"Transcriptional regulator, ArsR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IV76 at UniProt or InterPro

Protein Sequence (110 amino acids)

>HSERO_RS11595 ArsR family transcriptional regulator (Herbaspirillum seropedicae SmR1)
MTARAPVPSLALPAERMRQAAGEAVGALKVLANEDRLLLLCQLSQQEMCVSELEEQLDIR
QPTLSQQLGVLRNEGVVSTRRDGKRIYYRVADARLLEMLDLMYRLYCPKE