Protein Info for HSERO_RS11490 in Herbaspirillum seropedicae SmR1

Updated annotation (from data): D-ribose ABC transporter, permease component RbsC
Rationale: Specifically important for utilizing D-Ribose.
Original annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 60 to 88 (29 residues), see Phobius details amino acids 100 to 124 (25 residues), see Phobius details amino acids 129 to 129 (1 residues), see Phobius details amino acids 131 to 146 (16 residues), see Phobius details amino acids 168 to 191 (24 residues), see Phobius details amino acids 221 to 239 (19 residues), see Phobius details amino acids 251 to 269 (19 residues), see Phobius details amino acids 275 to 296 (22 residues), see Phobius details amino acids 303 to 319 (17 residues), see Phobius details PF02653: BPD_transp_2" amino acids 53 to 314 (262 residues), 179.5 bits, see alignment E=3.9e-57

Best Hits

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 100% identity to hse:Hsero_2295)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IUD2 at UniProt or InterPro

Protein Sequence (328 amino acids)

>HSERO_RS11490 D-ribose ABC transporter, permease component RbsC (Herbaspirillum seropedicae SmR1)
MQTSSSTPAASRQAAYLAGFKNYLGLMAALLAMCVMFAFLSENFLSAATFITLSNDIPPL
VVMSVGMTFILIIGGIDLSVGSVMALAASMLSMAMVRWGWPLYAAAPLGVVVAALCGTLT
GMVSVHWRIPSFIVSLGVLEIARGLAYQVTNSRTEYIGSAVDVISSPILFGMSPAFLSAI
AIVIIAQLVLTRTVLGRYWIGIGTNEEAVRLSGVNPNPSKILAFALMGALAGIAALFQVS
RLEAADPNGGVGMELQVIAAVVIGGTSLMGGRGSIVSTFIGVLIISVLEAGLAQVGVSEP
MKRIITGAVIVVAVILDTYRRRGQRHAR