Protein Info for HSERO_RS11275 in Herbaspirillum seropedicae SmR1

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 36 to 55 (20 residues), see Phobius details amino acids 61 to 83 (23 residues), see Phobius details amino acids 95 to 116 (22 residues), see Phobius details amino acids 122 to 141 (20 residues), see Phobius details amino acids 158 to 179 (22 residues), see Phobius details amino acids 198 to 220 (23 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 228 to 389 (162 residues), 143.7 bits, see alignment E=2.2e-46 PF00990: GGDEF" amino acids 232 to 385 (154 residues), 136.3 bits, see alignment E=4.3e-44

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_2257)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IU94 at UniProt or InterPro

Protein Sequence (395 amino acids)

>HSERO_RS11275 membrane protein (Herbaspirillum seropedicae SmR1)
MNAATASIALALVQFCGGLIMAGLFMNMPKEHCTRLWALSGLCGAAGICLMLVGYNHMGD
VWNPLALLAGNTGLFSCCLLAWAGLRSFYQRRTGWWPWLLVGFYAFLFSLLLLYQVSFTQ
RSYLALVALQLTFWLALGEFARGMSGPHAQRYARWSFGRCIGIVSLLIFISTHVARFVLS
FSHPELFIPPAMSNIGVALIYLIPLSGSLLFSVSLMMIYFERLLADRQRLATEDQLTGAL
NRRELVRCGELLLARAVERKSVLALAFIDVDHFKQINDRHGHLAGDRVLAGIGATLAQSC
RPGDVLGRYGGEEFCAVFPGVDHDQACQIGQRLLESVRTQRFEHGHPVTISVGLAVLQPG
NQRSWDELVHEADLALYRAKNEGRNAYRMAMSFGH