Protein Info for HSERO_RS11215 in Herbaspirillum seropedicae SmR1

Annotation: methionine sulfoxide reductase B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 131 TIGR00357: methionine-R-sulfoxide reductase" amino acids 7 to 130 (124 residues), 194.3 bits, see alignment E=3.9e-62 PF01641: SelR" amino acids 11 to 130 (120 residues), 189.9 bits, see alignment E=6.7e-61

Best Hits

Swiss-Prot: 78% identical to MSRB_HERAR: Peptide methionine sulfoxide reductase MsrB (msrB) from Herminiimonas arsenicoxydans

KEGG orthology group: K07305, peptide-methionine (R)-S-oxide reductase [EC: 1.8.4.12] (inferred from 100% identity to hse:Hsero_2246)

MetaCyc: 55% identical to methionine sulfoxide reductase B (Escherichia coli K-12 substr. MG1655)
L-methionine (R)-S-oxide reductase. [EC: 1.8.4.14]; Peptide-methionine (R)-S-oxide reductase. [EC: 1.8.4.14, 1.8.4.12]

Predicted SEED Role

"Peptide methionine sulfoxide reductase MsrB (EC 1.8.4.12)" (EC 1.8.4.12)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.12 or 1.8.4.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IU83 at UniProt or InterPro

Protein Sequence (131 amino acids)

>HSERO_RS11215 methionine sulfoxide reductase B (Herbaspirillum seropedicae SmR1)
MTKRVEKTEAQWREQLDPLEYQVTREAATERAFTGRYWDHHEAGTYTCVCCDTPLFTSDA
KFDSGCGWPSYFEPIDPANVREKVDRSYGMIRTEIICNVCDAHLGHVFPDGPPPTGLRYC
INSASLRFDPA