Protein Info for HSERO_RS11175 in Herbaspirillum seropedicae SmR1

Annotation: multidrug DMT transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 transmembrane" amino acids 18 to 39 (22 residues), see Phobius details amino acids 48 to 69 (22 residues), see Phobius details amino acids 90 to 107 (18 residues), see Phobius details amino acids 113 to 131 (19 residues), see Phobius details amino acids 137 to 154 (18 residues), see Phobius details amino acids 161 to 181 (21 residues), see Phobius details amino acids 193 to 214 (22 residues), see Phobius details amino acids 220 to 240 (21 residues), see Phobius details amino acids 252 to 272 (21 residues), see Phobius details amino acids 278 to 297 (20 residues), see Phobius details PF00892: EamA" amino acids 17 to 154 (138 residues), 30.7 bits, see alignment E=1.6e-11 amino acids 163 to 292 (130 residues), 50.5 bits, see alignment E=1.2e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_2238)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IU75 at UniProt or InterPro

Protein Sequence (314 amino acids)

>HSERO_RS11175 multidrug DMT transporter permease (Herbaspirillum seropedicae SmR1)
MSSAVLSQLPIARTHKLGILFLISGLWTLSLLDTAGKLLALAGYHVVMIAWMRYTINLFF
MAATLAPLYRRRHGRSILQSNRLGLQLGRGALLLGSTLIFFSVLKIVPLAEGTAMNFCAP
LIVLAISPWLLGERSYLSRWIAVLVGFTGMLIVIRPSGDIPPYGVALGLISALTQALLSI
LNRKASQADNPMVTLFYGALVGSVVSTLLVPFFWTSHTPTMVELAILVSTGITSTIGHFL
QNSAYRHAEASVLTPFFYAQIISACGMGWLVFGQFPDRVTVLGIAIICASGIGIAYIEHK
RAHPLPPADPMESV