Protein Info for HSERO_RS11100 in Herbaspirillum seropedicae SmR1

Annotation: plasmid stabilization protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 138 transmembrane" amino acids 33 to 53 (21 residues), see Phobius details PF01850: PIN" amino acids 2 to 121 (120 residues), 52.6 bits, see alignment E=3.7e-18

Best Hits

Swiss-Prot: 52% identical to Y4JK_SINFN: VapC ribonuclease Y4jK (NGR_a03040) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K07062, (no description) (inferred from 100% identity to hse:Hsero_2223)

Predicted SEED Role

"VapC toxin protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IU60 at UniProt or InterPro

Protein Sequence (138 amino acids)

>HSERO_RS11100 plasmid stabilization protein (Herbaspirillum seropedicae SmR1)
MIVLDTNVVSEAMKPAPDAAVQAWFNDQAPDTLYLTSITVAEIGFGIACLSAGRRQDLLA
RRFEGLLRMFKDRILPFDMDAARSHAELAAMARRAGRGFPTPDGYIAAIAASCGFLVASR
DVTPYLAAELTVINPWQA