Protein Info for HSERO_RS10755 in Herbaspirillum seropedicae SmR1

Annotation: sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 transmembrane" amino acids 16 to 39 (24 residues), see Phobius details amino acids 162 to 184 (23 residues), see Phobius details PF16524: RisS_PPD" amino acids 48 to 153 (106 residues), 136.8 bits, see alignment E=7e-44 PF00672: HAMP" amino acids 180 to 230 (51 residues), 46.4 bits, see alignment 7.9e-16 PF00512: HisKA" amino acids 237 to 290 (54 residues), 38 bits, see alignment 2.8e-13 PF02518: HATPase_c" amino acids 335 to 449 (115 residues), 76.2 bits, see alignment E=5.4e-25

Best Hits

KEGG orthology group: K07638, two-component system, OmpR family, osmolarity sensor histidine kinase EnvZ [EC: 2.7.13.3] (inferred from 100% identity to hse:Hsero_2153)

Predicted SEED Role

"Osmolarity sensory histidine kinase EnvZ"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IT93 at UniProt or InterPro

Protein Sequence (455 amino acids)

>HSERO_RS10755 sensor histidine kinase (Herbaspirillum seropedicae SmR1)
LPMKVRTQSGWFSNGLFWRTFFLLTFLITASMVAWVASFRMVERGPRAEQLAAQIVSVVT
ITRAALTHSAPEMRRELLFDLASNEGIRIYPLEKSDRIVPPEDSPIVPELEYYVRQSLDE
NTLFASSVNDVEGFWISFNIDDDKYWLMLDRGRLDRTSSLQWLGWGSIALFLSLIGAVFI
STLINQPLARLTAAARAIAKGRQPEPLPESGPTEIEEANRSFNQMVADLNRIESDRALIL
AGISHDLRTPLARMQLEVEMANLSDEARDGMHSDLAQMDSIIGQFLDYAKPFDTSSLETI
DLADVLQDVAGNASRLSDIRVHTQITPDTQVAGNGTELARVFSNLVENARRYGKTEGTDC
AEIDIRSRIEGHQVVVEVADHGPGVPVNECERLLRPFTRLDTARGQANGSGLGLAIVNRI
VLKHNGKLLLKGHEETRSGLLVQITLPLQGHRRHA