Protein Info for HSERO_RS10675 in Herbaspirillum seropedicae SmR1

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 683 TIGR00229: PAS domain S-box protein" amino acids 122 to 238 (117 residues), 87.5 bits, see alignment E=7.7e-29 PF00989: PAS" amino acids 125 to 230 (106 residues), 54.4 bits, see alignment E=4.3e-18 PF08448: PAS_4" amino acids 128 to 234 (107 residues), 30.8 bits, see alignment E=1e-10 PF13426: PAS_9" amino acids 134 to 232 (99 residues), 59.1 bits, see alignment E=1.6e-19 PF08447: PAS_3" amino acids 145 to 226 (82 residues), 37.3 bits, see alignment E=9.8e-13 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 241 to 400 (160 residues), 136.3 bits, see alignment E=8.2e-44 PF00990: GGDEF" amino acids 244 to 400 (157 residues), 154.3 bits, see alignment E=8.7e-49 PF00563: EAL" amino acids 425 to 657 (233 residues), 243.1 bits, see alignment E=9.5e-76

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_2137)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IT78 at UniProt or InterPro

Protein Sequence (683 amino acids)

>HSERO_RS10675 diguanylate cyclase (Herbaspirillum seropedicae SmR1)
MLSSVGTDDLACCSALLEAMQNLHGMALHAALGGIASGLLKRPGGRYVIGASAPVEGGLC
QPVQCEGALFGHFVFPPLTRPYSDQERQRLAMLAAFLGRLMQGRADTEQRVRALDQIEAK
LEQQAQILNQMHESVITMDPAGFITSWNRGAEQLFGYSAMEAIGRNVLFLYENEDEEDSL
HDLFLEHGGREMEVRRRKKSGEVFWASLSLSVMRDQNGHPIGLIGYLNDITERKNAEKLI
HHLAYYDALTGLPNRTLLTRTVDQALEEARHENLHGCVMFIDLNRFKPINDTLGHVAGDM
LLVEVAMRLRRALREQDVVARLGADEFAVALFGIDKDSPAYVAQKLLALFDDPFFIDGHE
LRVGASIGVSLYPENATDTETLLRLADIAMYRAKQGGENNEGGYACYSEEMNRNTLDLLR
IETGLLHAFEYNELLLYYQPKVDMQTLAITGAEALVRWQHPERGLLLPGEFIPIAEETGL
IVQLSDWVLDAVCRQARAWKDAGLPPIRIALNVTAREFTRSLPDRVGAALERHMLSGEWL
ELEITESMLMHSTDRVISIMEKICGLGITVSLDDFGTGYSSLSYLKRFPINTLKIDRSFT
MGIPDDTNDCAIASAIIGIAKQLRHKVIAEGVEDEKQFNFLREAGCNELQGYIFSRPVPA
PDFHAMLLEGRKLALESASASQA