Protein Info for HSERO_RS10550 in Herbaspirillum seropedicae SmR1

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 572 transmembrane" amino acids 5 to 25 (21 residues), see Phobius details amino acids 342 to 365 (24 residues), see Phobius details PF02743: dCache_1" amino acids 135 to 275 (141 residues), 47.8 bits, see alignment E=2e-16 PF00672: HAMP" amino acids 361 to 410 (50 residues), 42.1 bits, see alignment 1.3e-14 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 410 to 566 (157 residues), 134.7 bits, see alignment E=1.3e-43 PF00990: GGDEF" amino acids 413 to 567 (155 residues), 132 bits, see alignment E=2.7e-42

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_2111)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IT52 at UniProt or InterPro

Protein Sequence (572 amino acids)

>HSERO_RS10550 histidine kinase (Herbaspirillum seropedicae SmR1)
LQRLFILPFVFLMVCLVLTIGWFLYRAGDDATEVLARNALTELIGRVSQAIDRQTMGARE
SLNVVAPPAVRTAAPGQPPAMLPFPVHSKELEERLWLANLMFEDPSYVYFGGADGSFLGI
KQEEGSQFTYSVREPDGKNYVYQLRGPGTPMELVAAQEYEPRKRPWYVQAVQRGRETWSS
VYADYRQKHLGINLSKPIFDADGKLLGVANSSIGLLRLTTLLRALPLGAHGVAFVTELNG
DMIADSVNEPLHQIRDQDPDLRRLNASQSSSPLVRQAYEEVRRYLARQPAQSGKLMLLSS
RTEGGKIEVAFRLHHDAAGLDWLAISAAPRSDFLGSVTSGVYQTLMLGLMAVCLTFVIGF
LLLRWVLRDIRRLTQAAKSIGNGSPFPDLNINRNDEIGQLAQSFVEMERNLRTDRLTNVL
NRDSLIAQIDFRRSNCVDGSPLHFGLLFIDLDRFKAVNDEYGHDEGDKVLVTIAQRLQHT
LRHDDSVARFGGDEFVVYLHGVSDMEVARSIADKIRHAVNKPIPGREGQQYVVDASVGVS
LYPDDGLDVETLLRVADSRMFDQKRLHRILSV